Details for Lyrate rockcress Locus 16060698

Position : sca3 ( 5`- 22194414 .. 22195295 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060698

Protein [Map View]
MAMKMIKNHVRSISLPSRSHPSTAAIEESLEKFIITMNTSTMTSSKSVYSGLSGLEDLYDCTEDLLKMGSTQRVLSFNDE
KKKKKKKMMKGEFMEEMLDGSLRLMDICNVSRDLMVETHEHVLGLQSCVRRRKDFDVSGYVGFRKNMRKEVKKLLGSLKN
INVGLVMKDHGYDQDGDIHLLAVIHAMRRVVSMTVSVLKSFLEFLSGRQNGNDIRSKLALVLMNKKFHDHDKMVKNELEN
VDSAICGDSISYDDLHVKLEEVEVWIRRFEKSLEELFRGMIRTRALLLNIISQ*

DNA
ATGGCGATGAAGATGATCAAGAACCATGTAAGATCTATTAGCTTACCATCAAGATCTCATCCTAGCACCGCAGCGATTGA
GGAGTCGCTGGAAAAATTTATTATCACTATGAACACGTCGACAATGACGTCGTCTAAGTCCGTTTACTCCGGTTTATCGG
GGCTGGAGGATCTGTACGACTGTACCGAAGATCTTCTTAAGATGGGTTCGACGCAAAGAGTGTTGTCGTTTAATGATGAG
AAGAAGAAGAAGAAGAAGAAGATGATGAAGGGAGAGTTTATGGAGGAAATGCTTGATGGTTCGTTGAGGCTAATGGATAT
ATGCAACGTCTCGAGGGATCTCATGGTTGAGACTCATGAGCATGTTCTTGGTCTTCAGTCTTGTGTTAGGAGAAGGAAAG
ATTTCGATGTCTCGGGCTATGTCGGATTTAGGAAGAATATGAGGAAAGAAGTGAAGAAGCTTCTTGGATCGTTAAAGAAC
ATTAATGTAGGGTTAGTAATGAAAGATCATGGTTATGATCAAGACGGTGATATTCATTTATTGGCCGTGATTCATGCAAT
GAGACGTGTCGTTTCAATGACAGTTTCGGTCTTGAAGTCGTTCTTGGAGTTCTTGTCGGGACGACAAAACGGGAATGACA
TAAGGAGCAAATTGGCTTTGGTCCTCATGAACAAGAAGTTTCATGATCACGATAAGATGGTCAAAAATGAGTTGGAGAAT
GTAGATTCAGCGATTTGTGGAGATTCTATCTCTTATGATGATCTTCATGTGAAGCTTGAGGAAGTTGAGGTATGGATTCG
AAGGTTCGAGAAGAGTCTAGAAGAATTATTTCGAGGGATGATTAGAACACGAGCCTTGCTTCTCAACATAATCTCTCAAT
AG