Details for Lyrate rockcress Locus 16060680

Position : sca3 ( 5`- 8738216 .. 8736801 -3` )
Annotation : [B2G] pepsin a
External links : CoGe
PGDD synteny : 16060680

Protein [Map View]
MLLPLFFFFFFLLHLHLSSSSISFPDFQSIDVLQPPLTVTETLPDFNNTHFSDDSNSKYTLRLLHRDRFPSVTYRNHHHR
LHARMRRDTDRVSAILRRISGKVVVASSDSRYEVNDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQC
QPCKLCYKQSDPVFDPAKSGSYTGVSCGSSVCDRIENSGCHSGGCRYEVMYGDGSYTKGTLALETLTFAKTVVRNVAMGC
GHRNRGMFIGAAGLLGIGGGSMSFVGQLSGQTGGAFGYCLVSRGTDSTGSLVFGREALPVGASWVPLVRNPRAPSFYYVG
LKGLGVGGVRIPLPDGVFDLTETGDGGVVMDTGTAVTRLPTGAYAAFRDGFKSQTANLPRASGVSIFDTCYDLSGFVSVR
VPTVSFYFTEGPVLTLPARNFLMPVDDSGTYCFAFAASPTGLSIIGNIQQEGIQVSFDGANGFVGFGPNVC*

DNA
ATGCTCCTCCCTCTCTTCTTCTTCTTCTTCTTCCTCCTCCATCTCCATCTTTCTTCTTCCTCAATCTCCTTCCCTGATTT
TCAAAGCATCGACGTTTTACAACCTCCTCTCACCGTCACTGAAACTCTTCCCGATTTCAACAACACCCATTTCTCCGATG
ATTCCAATTCTAAATACACTCTTCGTCTTCTCCACCGCGACAGATTCCCTTCCGTCACTTACCGTAACCACCACCACCGT
CTCCATGCTCGTATGCGCAGAGATACAGACAGAGTCTCCGCCATTCTCCGCCGCATTTCTGGGAAAGTTGTTGTAGCTTC
TTCCGATTCTAGATACGAGGTTAACGATTTTGGGTCCGATGTTGTTTCCGGTATGGATCAAGGAAGTGGTGAGTATTTCG
TCAGAATCGGCGTCGGAAGTCCTCCGAGAGATCAGTACATGGTCATTGATTCCGGTAGTGATATGGTTTGGGTTCAGTGC
CAGCCTTGTAAGCTCTGTTACAAACAATCCGACCCGGTTTTTGACCCGGCTAAATCCGGGTCTTACACTGGAGTCTCTTG
TGGCTCTTCCGTATGTGACCGGATTGAAAACTCCGGCTGTCACTCCGGTGGATGCCGTTACGAGGTCATGTACGGAGACG
GTTCTTACACGAAAGGGACGTTAGCTCTCGAAACGCTGACGTTTGCTAAGACGGTGGTTAGAAACGTTGCGATGGGATGT
GGTCACCGGAACAGAGGAATGTTTATCGGAGCTGCTGGGTTATTGGGTATTGGAGGCGGTTCAATGTCTTTTGTGGGTCA
ATTGAGCGGTCAAACCGGTGGTGCGTTCGGTTATTGTTTAGTGAGTCGAGGCACAGACTCGACCGGCTCATTGGTATTCG
GGCGGGAAGCTTTGCCCGTTGGTGCCTCGTGGGTACCGTTGGTCCGGAACCCACGGGCTCCGAGTTTTTACTATGTTGGG
CTCAAGGGCCTCGGGGTCGGAGGCGTCCGGATTCCTTTACCGGATGGTGTCTTTGACCTGACGGAAACCGGTGACGGCGG
TGTGGTTATGGATACCGGAACCGCCGTCACAAGGCTTCCTACGGGGGCTTATGCCGCATTTCGAGATGGATTCAAGTCGC
AGACTGCGAATTTGCCGCGGGCTTCCGGTGTATCGATATTCGACACGTGTTATGATCTGTCAGGGTTTGTCTCGGTACGA
GTCCCGACCGTGTCGTTCTATTTCACGGAAGGTCCTGTTTTGACATTACCGGCGAGGAATTTTCTGATGCCGGTGGATGA
TTCGGGGACATATTGTTTTGCGTTTGCGGCGTCTCCGACGGGTTTGTCGATAATAGGGAACATACAACAAGAAGGGATTC
AAGTATCTTTCGACGGAGCCAATGGCTTTGTTGGTTTTGGCCCCAACGTTTGCTAG