Details for Lyrate rockcress Locus 16060671

Position : sca3 ( 5`- 4562305 .. 4563960 -3` )
Annotation : [B2G] initiation factor 3g
External links : CoGe
PGDD synteny : 16060671

Protein [Map View]
MTIDSQQKTTSKFRWGEMDEDDDFDFLLPPKQVIGPDENGLKTTIEYKFNDEGSKVKITTRTRVRKLASARLNKRAMERR
NWPKFGDAANEEAGSHLTMVSTEEILLERPRAPGTKADESKATGDGLSQLGKGGAVLMVCRICHKKGDHWTSKCPYKDLA
ATTDAFIDKPPTGEPSTMSAAPGTGKAAYVPPSMRAGADRSAVGSDMRRRNDENSVRVTNLSEDTREPDLMELFHPFGAV
TRVYVAIDQKTGVSRGFGFVNFVSREDAQRAINKLNGYGYDNLILRVEWATPRPT*

DNA
ATGACGATCGATTCACAGCAGAAAACGACGAGCAAGTTCAGATGGGGGGAAATGGACGAAGACGACGATTTTGATTTCTT
GCTCCCTCCCAAGCAGGTGATTGGCCCAGACGAGAATGGTTTAAAGACGACGATTGAGTACAAATTCAACGATGAGGGCA
GTAAGGTTAAGATTACGACTAGGACACGTGTCCGGAAGCTAGCTTCTGCTCGGCTCAACAAACGAGCTATGGAGAGGAGG
AACTGGCCTAAGTTTGGAGACGCAGCCAATGAGGAAGCTGGTAGCCATCTCACTATGGTTTCTACTGAAGAGATTCTTCT
CGAACGACCCAGAGCTCCTGGTACCAAAGCAGATGAATCAAAGGCAACAGGAGACGGCTTGTCTCAGCTGGGTAAAGGTG
GTGCAGTTCTCATGGTGTGCAGGATATGCCACAAGAAAGGAGATCACTGGACATCAAAATGTCCTTACAAGGATCTAGCT
GCAACAACTGATGCCTTCATCGACAAGCCACCCACAGGGGAACCATCTACCATGTCCGCTGCACCTGGAACTGGCAAAGC
CGCATATGTCCCGCCTAGCATGAGAGCAGGTGCAGACAGAAGCGCTGTTGGTTCAGACATGAGGAGGAGGAACGATGAGA
ACTCAGTGCGTGTAACCAACTTGTCTGAAGATACCCGTGAACCGGACTTGATGGAGCTGTTCCATCCGTTTGGAGCTGTC
ACACGTGTCTATGTGGCCATCGATCAGAAAACTGGAGTGAGCAGAGGATTTGGTTTCGTCAATTTCGTGAGCAGGGAAGA
CGCTCAACGGGCAATCAACAAGTTGAATGGTTATGGTTATGATAACCTCATCCTCAGGGTTGAATGGGCCACTCCAAGAC
CAACCTAG