Details for Lyrate rockcress Locus 16060638

Position : sca3 ( 5`- 5715299 .. 5716554 -3` )
Annotation : [B2G] structural constituent of ribosome
External links : CoGe
PGDD synteny : 16060638

Protein [Map View]
MAAKTLIRSGASLMNRFLSKPTTNLVQNNLRSSFQQIAPQGQEIPPYFFPSLSNLQSSLISRPNDTASLQELNERGFLYP
SGLPSLEFFLPEVDPSSEPLLLFPKRTFQPSTIRRKRNHGFFARKATKGGRRVIARRIAKGRHRVTA*

DNA
ATGGCGGCCAAAACCCTAATCAGGTCAGGAGCTTCATTGATGAATCGGTTTCTATCGAAGCCGACGACGAATCTTGTGCA
GAACAATCTCAGATCTTCGTTTCAACAGATAGCTCCTCAGGGACAAGAAATCCCTCCGTATTTTTTCCCGTCGTTGTCGA
ATCTACAGAGCTCACTCATTTCGCGCCCTAACGACACTGCTTCGCTCCAGGAACTCAACGAACGTGGGTTTCTTTACCCT
TCTGGTCTTCCTTCACTCGAATTCTTCTTACCAGAAGTTGATCCTTCAAGTGAGCCATTGCTTCTGTTTCCTAAGAGGAC
ATTCCAACCAAGCACTATTAGGCGTAAACGAAACCATGGATTCTTTGCTCGGAAGGCAACCAAAGGTGGACGGAGAGTTA
TAGCTCGGAGAATAGCAAAAGGGCGTCACAGAGTCACTGCCTAG