Details for Lyrate rockcress Locus 16060619

Position : sca3 ( 5`- 9111298 .. 9110285 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060619

Protein [Map View]
MASSTLFKLNSQTLKALNPSPPSLSPPNSRIFHLHFSKSLSQQQHSKLNHKSTTTRFFVPLCFSLPSPSSPPISKEEAIL
QAKTCLLSCLIKPLNNPKLASPKLRKLKQPRFRLEIPILDDDSPSSLSQLAFSIFHDLPISRRGSNVKILFLWPDPSFID
SAVKAFRSDSVNHIAMSPVSDSVNKALRSADVAVFMAPEKTQVEDVKTASEAFSSKPVVMINPRWLFEEEKGFGDGFIGS
FEVIYAFTGLEVRGVLSKRKGVIFKCVRDGVVSGERWNVLVEEEEGNGILKVVSQFNSRPSMEEVELVLYNLMAMNSPIT
KSAKFLKDLVSNITGKK*

DNA
ATGGCTTCTTCGACTCTCTTCAAACTTAATTCACAGACTTTGAAAGCACTAAACCCTTCTCCACCTTCGTTATCTCCTCC
TAATTCCAGAATTTTCCATCTTCATTTCTCCAAATCACTCTCACAACAACAACATTCAAAGCTCAACCACAAATCAACAA
CTACTCGTTTCTTCGTTCCTCTCTGTTTCTCTCTTCCTTCACCTTCTTCTCCTCCAATTTCCAAAGAAGAAGCCATTCTT
CAAGCCAAGACTTGTCTCCTTTCTTGTCTCATCAAACCCTTAAACAACCCAAAACTCGCTTCCCCAAAACTCAGGAAGCT
CAAACAACCAAGATTCCGTCTTGAAATCCCAATCCTTGACGATGATTCTCCTTCGTCTCTCTCTCAGCTCGCTTTTTCGA
TCTTCCATGACTTACCCATCTCGAGAAGAGGCTCCAATGTCAAGATTCTCTTCCTCTGGCCTGACCCTTCATTCATCGAT
TCCGCCGTTAAAGCTTTCCGGTCAGACTCTGTTAACCACATTGCCATGTCTCCTGTTTCAGACTCTGTTAACAAAGCTCT
GAGATCTGCTGACGTGGCGGTTTTCATGGCTCCGGAGAAAACGCAGGTGGAGGATGTGAAGACGGCGAGTGAAGCTTTTT
CTTCGAAACCTGTGGTGATGATCAATCCGAGATGGTTGTTTGAGGAAGAGAAAGGATTTGGTGATGGCTTTATTGGTTCC
TTTGAAGTGATTTATGCGTTCACAGGTTTAGAAGTGAGAGGAGTGTTGAGTAAGAGAAAAGGAGTGATCTTTAAGTGTGT
GAGAGATGGTGTTGTGAGTGGAGAGAGATGGAATGTTCTTGTTGAAGAAGAAGAAGGTAATGGAATTTTGAAAGTGGTTT
CACAATTCAACTCTCGGCCATCGATGGAAGAAGTTGAGCTTGTTCTGTATAACTTGATGGCTATGAATTCTCCTATCACC
AAATCAGCTAAGTTTCTGAAAGATTTGGTTTCAAACATCACTGGGAAGAAGTAA