Details for Lyrate rockcress Locus 16060601

Position : sca3 ( 5`- 10102526 .. 10101842 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060601

Protein [Map View]
MKMGMSLVFLTVFMAVMSSTRVSAQSSCTNVLISLAPCLNYITGNSTSPTQQCCRQLGSVVQSSPACLCQVLNGGGSQLG
INVNQTQALGLPTACNVQTPPVSRCNTAGGGGGGSSSDSPAESPNSSGPGSGSKTIPAGEGDGPSSDGSSIKFSFPFLAF
LSAASYIAIF*

DNA
ATGAAAATGGGAATGAGTTTAGTGTTTCTTACAGTTTTTATGGCAGTGATGTCTTCTACAAGGGTCTCTGCCCAGTCCAG
CTGTACAAATGTGTTGATTAGCTTGGCGCCGTGTCTCAACTACATAACCGGAAACTCTACCTCTCCTACTCAGCAATGCT
GTCGTCAGTTGGGTAGCGTAGTCCAGTCTTCTCCTGCCTGTTTGTGTCAAGTCCTCAACGGTGGAGGCTCTCAGCTTGGG
ATCAATGTTAACCAAACACAAGCTCTTGGTCTGCCAACGGCTTGTAATGTTCAGACTCCTCCTGTCAGTCGCTGTAATAC
CGCTGGTGGTGGTGGTGGTGGTTCTTCTTCTGACTCTCCTGCAGAATCACCAAACTCTTCAGGACCAGGAAGTGGATCGA
AAACCATACCAGCAGGGGAAGGAGACGGACCATCGTCTGATGGAAGCTCTATCAAGTTCTCATTTCCCTTTCTTGCCTTC
CTTTCCGCAGCTTCCTACATCGCAATCTTCTGA