Details for Lyrate rockcress Locus 16060589

Position : sca3 ( 5`- 3161762 .. 3161193 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060589

Protein [Map View]
MTGVENGVRMTSPETSSTSSLATTSVHVSALDGLVNVNSLFTIAVFVGLSLATPGQHSLEQRSSCDASADVAKKLLVFEV
VSFSFFLFSSLVAQGLKLALNLLNSKDVNEIFRAHINIKVLRWGMMASAVGSVMGCLFLMLSMVNVIQIRLGLLSCGSKS
AAQAVATLVTLVSSALLIYISTAIYAFWH*

DNA
ATGACCGGCGTTGAGAACGGCGTGAGAATGACGTCACCAGAGACGTCTTCAACATCCTCCCTCGCCACCACAAGTGTCCA
CGTAAGTGCTCTCGACGGACTCGTGAACGTGAACTCTCTCTTCACCATCGCCGTCTTCGTAGGTCTTTCGTTAGCGACTC
CAGGACAACACAGCCTCGAACAACGATCCAGCTGCGATGCAAGTGCTGACGTGGCCAAGAAGCTACTGGTCTTCGAAGTC
GTCTCCTTCAGCTTCTTCCTCTTCTCCTCTCTCGTAGCTCAGGGTCTTAAGCTTGCCTTAAACCTTCTTAATAGCAAAGA
CGTCAACGAGATTTTCAGAGCTCACATCAATATCAAGGTTTTGAGATGGGGAATGATGGCTTCTGCTGTCGGATCTGTCA
TGGGCTGTCTCTTCTTGATGCTCTCTATGGTTAATGTGATTCAGATCCGTCTTGGTTTGCTCTCTTGCGGCAGCAAATCG
GCTGCTCAAGCGGTTGCAACGCTCGTCACTCTGGTTTCCTCTGCTCTGCTGATTTACATCTCTACCGCCATTTACGCTTT
CTGGCATTGA