Details for Lyrate rockcress Locus 16060543

Position : sca3 ( 5`- 6468790 .. 6471049 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060543

Protein [Map View]
MADRNWLISFEDLPSHLILEVLTSGKLSAVDLLSLELTSKVFGGSHGFYPLKFRSLADYAASQLCSMHPVYVGMGLTTQK
ELFANCEGNWKRLLSFLQSVEQSSDMVETSQGKMQIATGKYHTLLINNSKVYSCGVSLSGVLAHGPETTQCVAFTPIEFP
FPAQVAQVSATQNHSAFVLQSGEVLTCGDNSSHCCGHLDTSRPIFRPKLVEVLKGTPCKQVAAGLHFTVFLSREGHAYTC
GSNTHGQLGHGDTMDRPAPKVVEFLKNIGPVVQIAAGPSYVLAVTQDGSVYSFGSGSNFCLGHGEQQDELQPRVIQAFKR
KGIHILRVSAGDEHAVALDSNGRVYTWGKGYCGALGHGDENDKITPQVLVNLKNCLAVQVCARKRKTFVLVEGGLLYGFG
WMGFGSLGFPDRGVSDKVLRPRVLECLKPHRVSQVSTGLYHTIVVTQGGRIFGFGDNERAQLGHNSLRGCLEPTEIFLHC
GRSRSRLC*

DNA
ATGGCTGACCGAAACTGGTTGATTTCGTTCGAGGATCTTCCTTCTCATTTGATCTTGGAGGTGTTGACCTCTGGGAAGCT
TAGTGCGGTTGATCTACTTAGCTTGGAATTGACCTCTAAGGTTTTCGGAGGGAGCCATGGATTCTACCCTTTAAAATTCA
GATCACTAGCTGATTATGCGGCGTCTCAGCTTTGCTCTATGCATCCTGTCTATGTGGGAATGGGTTTGACTACACAGAAA
GAGCTCTTTGCCAATTGTGAGGGAAACTGGAAGCGGCTTTTGAGTTTCTTACAGTCAGTTGAGCAATCCTCAGATATGGT
TGAAACCTCTCAAGGCAAAATGCAAATTGCAACAGGAAAGTATCACACTTTGCTAATCAACAACTCAAAGGTTTATTCTT
GTGGTGTAAGTTTGTCCGGTGTTCTTGCTCATGGCCCTGAAACTACTCAATGCGTAGCATTTACGCCTATAGAGTTTCCG
TTCCCTGCACAAGTGGCTCAAGTCTCAGCCACACAGAACCATTCTGCTTTCGTATTGCAATCTGGAGAGGTTCTCACTTG
TGGGGATAATTCATCGCATTGCTGTGGTCATTTAGATACTAGCCGTCCAATATTTAGGCCTAAGCTTGTTGAGGTTTTGA
AGGGGACTCCTTGTAAGCAGGTGGCTGCTGGGCTTCACTTCACTGTGTTTCTATCAAGAGAAGGGCATGCGTATACTTGT
GGATCAAATACACATGGGCAGCTTGGTCATGGCGATACTATGGACAGACCAGCACCCAAAGTTGTTGAGTTTCTTAAAAA
CATTGGCCCTGTGGTGCAAATCGCAGCTGGACCCAGCTATGTTTTAGCTGTAACACAGGATGGCTCGGTTTACTCGTTTG
GCTCTGGTTCTAACTTCTGTCTTGGTCATGGAGAGCAACAGGACGAGCTCCAGCCGCGTGTTATTCAGGCTTTTAAAAGA
AAAGGTATTCATATACTCCGTGTCTCTGCTGGCGATGAACATGCCGTGGCACTTGATTCCAATGGCCGTGTCTACACATG
GGGTAAAGGTTACTGCGGTGCTCTAGGCCATGGAGACGAAAATGACAAGATCACTCCTCAAGTTTTGGTCAATCTCAAGA
ATTGCCTAGCTGTCCAGGTGTGTGCAAGAAAAAGGAAGACTTTTGTTTTGGTGGAAGGTGGATTATTGTATGGATTTGGG
TGGATGGGGTTTGGAAGCCTTGGGTTCCCGGACAGAGGAGTTTCAGACAAAGTTCTGAGGCCAAGAGTATTGGAGTGTCT
GAAACCACACCGTGTCTCTCAAGTTAGCACTGGTTTGTATCACACCATTGTGGTCACTCAAGGTGGTCGGATTTTTGGAT
TTGGAGATAACGAAAGAGCTCAGCTTGGTCACAACTCACTCCGCGGGTGCTTAGAACCAACCGAAATCTTTCTCCATTGT
GGCCGTTCTCGTAGCCGGCTTTGTTGA