Details for Lyrate rockcress Locus 16060498

Position : sca3 ( 5`- 4216591 .. 4218958 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060498

Protein [Map View]
MEMSSEDNNLMEKVLPPVEQESDVELETTVKKYLRGEGANLETLKDKKLKTQLASREKLYGKSAKAAAKIEKWLLPAEAG
YLETEGLEKTWRVKQSDIANEVDILSSRNQYDIVLPDFGPYKLDFTASGRHMLAGGRKGHLALLDMMNMSLIKEIQVRET
VRDVAFLHNEQFFAAAQKKYAYIYGRDGTELHCLKERGPVARLRFLKNHFLLASVNKSGQLHYQDVTHGGMVASIRTGKG
RTDVMEVNPYNGVVALGHSGGTVTMWKPTSQAPLVQMQCHPGPVSSVAFHPNGHLMATSGKERKIKIWDLRKFEEVQTIH
SFHAKTLSFSQKGLLAAGTGSFVQILGDSSGGSSHNYSRYMNHSMVKGYQIEKLMFRPYEDVIGIGHSMGWSSILIPGSG
EPNFDSWVANPFETSKQRREKEVHSLLDKLPPETIMLDPSKIGAMRPSRRREKPSRGEIEAEKEVAIEAAKSTELKNKTK
GRNKPSKRTKKKKEMVENAKRTFPEQEHNTALKKRRIGEDAAAELPASLKRFARKN*

DNA
ATGGAGATGAGTTCAGAGGATAACAATCTTATGGAGAAAGTTTTGCCTCCTGTTGAGCAGGAGAGTGATGTTGAGCTGGA
GACTACAGTTAAGAAATATCTTAGAGGAGAAGGTGCTAATCTTGAGACATTGAAAGATAAGAAACTAAAGACTCAACTTG
CTTCACGAGAAAAGTTGTATGGGAAGTCTGCCAAAGCTGCTGCTAAAATCGAGAAGTGGCTCTTGCCTGCTGAGGCAGGC
TACTTGGAGACTGAAGGTCTAGAGAAGACATGGCGAGTCAAGCAGTCAGATATTGCCAACGAAGTAGATATATTAAGCTC
AAGAAACCAATATGACATAGTGCTCCCAGATTTTGGCCCATACAAACTTGATTTTACGGCAAGTGGTCGGCATATGTTAG
CTGGTGGTCGCAAAGGCCACCTTGCTCTTTTAGACATGATGAATATGAGCTTAATTAAAGAGATTCAGGTAAGAGAAACA
GTACGTGATGTTGCATTCCTGCACAATGAACAATTCTTTGCAGCTGCCCAGAAGAAGTATGCTTATATATATGGGAGAGA
TGGAACTGAGCTGCATTGTTTGAAGGAACGTGGTCCAGTGGCCAGACTTCGGTTCCTAAAGAACCATTTCCTACTTGCAT
CAGTAAACAAATCTGGGCAGCTACATTATCAAGATGTAACCCATGGAGGCATGGTTGCTAGTATCCGAACAGGTAAAGGC
CGAACAGATGTAATGGAAGTGAATCCTTACAATGGTGTTGTTGCCTTGGGACATTCTGGTGGAACTGTCACAATGTGGAA
ACCCACTAGCCAAGCACCTCTTGTCCAGATGCAGTGTCACCCTGGGCCAGTGTCATCTGTCGCATTTCATCCAAATGGTC
ATCTCATGGCTACATCCGGTAAAGAGCGTAAAATCAAGATCTGGGATTTACGTAAATTCGAGGAAGTTCAAACTATCCAC
AGTTTTCATGCCAAAACGCTGAGTTTCAGTCAGAAAGGTTTGCTAGCAGCTGGAACTGGATCCTTTGTTCAGATTTTAGG
AGATTCGAGTGGTGGTTCTTCACATAACTATAGTAGATACATGAACCACTCGATGGTGAAAGGTTATCAAATCGAGAAGC
TTATGTTCAGACCATATGAGGATGTTATTGGGATTGGTCACTCGATGGGTTGGTCTAGCATTCTAATTCCAGGGTCTGGA
GAACCCAATTTCGATTCATGGGTGGCTAATCCATTTGAAACATCGAAACAGAGACGGGAGAAGGAAGTCCATTCGCTTCT
TGATAAGCTTCCACCTGAGACAATAATGCTCGACCCTTCAAAGATTGGTGCGATGAGACCCTCTAGGAGGAGAGAGAAGC
CATCAAGAGGAGAGATAGAAGCTGAAAAAGAGGTGGCCATAGAAGCAGCAAAGAGCACTGAGCTGAAGAACAAGACGAAA
GGAAGGAATAAACCGAGCAAGCGGACCAAGAAGAAGAAAGAGATGGTGGAGAACGCAAAGCGAACATTCCCGGAGCAAGA
GCACAACACCGCGTTGAAGAAGAGAAGAATCGGAGAAGATGCTGCGGCGGAGCTACCGGCGAGTTTGAAGAGATTTGCAC
GGAAAAACTGA