Details for Lyrate rockcress Locus 16060490

Position : sca3 ( 5`- 1820533 .. 1819501 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477783 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16060490

Protein [Map View]
MATQFSASVSMQTSCLATTRISFQKPALISNHGRTNLSFNLRRSIPSRRLSVSCAAKQETIEKVSEIVKKQLSLTPDKKV
VAETKFADLGADSLDTVEIVMGLEEEFNIQMAEEKAQKIATVEQAAELIEELIKEKK*

DNA
ATGGCGACTCAATTCAGCGCTTCTGTCTCCATGCAAACTTCTTGTCTGGCAACAACAAGGATTAGTTTCCAAAAGCCAGC
ATTGATTTCCAACCATGGAAGGACTAATCTCTCCTTCAACCTGCGCCGTTCTATCCCATCTCGCCGCCTCTCTGTTTCTT
GCGCGGCAAAACAAGAGACGATAGAAAAAGTTTCTGAGATAGTGAAGAAGCAGCTATCACTTACACCGGATAAAAAAGTC
GTTGCAGAAACCAAATTTGCTGACCTTGGAGCAGATTCTCTCGACACGGTTGAGATAGTGATGGGTTTAGAGGAAGAGTT
TAACATCCAAATGGCCGAAGAGAAAGCTCAGAAGATTGCCACAGTGGAGCAAGCTGCTGAACTCATCGAAGAGCTCATCA
AGGAGAAGAAGTAA