Details for Lyrate rockcress Locus 16060489

Position : sca3 ( 5`- 4390510 .. 4389139 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478435 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16060489

Protein [Map View]
MSVIGTKSCIFSVTIYSRGNEISSCFTSINKKSSIDLRFPRNLAGVSCKISGENPRTNGVSLSSKNKMEDYNTAMKRLMR
SPYEYHHDLGMNYTLIRDELIVGSQPQKPEDIDHLKQEQNVAYILNLQQDKDIDYWGIDLDSIVRRSKELGIRHMRRPAK
DFDPLSLRSQLPKAVSSLEWAVSEGKGRVYVHCSAGLGRAPGVSIAYMYWFCDMNLNTAYDNLVSKRPCGPNKGAIRGAT
YDLAKNDPWKEPFESLPENAFEDIADWERKLIQERVRALRGT*

DNA
ATGAGTGTGATTGGAACCAAAAGCTGTATTTTCTCGGTGACTATATATTCCCGAGGAAATGAGATTTCTTCTTGCTTCAC
TTCTATCAACAAGAAATCGTCAATTGATCTGAGATTTCCCAGAAATCTGGCGGGAGTTTCCTGCAAAATCTCTGGAGAAA
ATCCAAGAACAAATGGGGTTTCTCTTAGCTCCAAGAACAAAATGGAGGATTACAATACAGCTATGAAGAGATTGATGAGG
AGCCCTTATGAATATCATCATGATCTGGGTATGAACTATACATTGATAAGAGATGAACTTATCGTTGGGTCGCAGCCACA
GAAACCTGAGGACATAGATCACTTGAAGCAGGAACAGAATGTTGCTTACATACTTAACTTGCAGCAGGACAAGGACATTG
ACTATTGGGGAATCGATTTGGATTCCATTGTTCGAAGATCTAAGGAGCTTGGAATCCGTCACATGAGAAGGCCCGCTAAA
GATTTCGATCCACTTTCGTTGAGAAGCCAACTTCCAAAAGCTGTTTCTTCTTTGGAATGGGCGGTTTCAGAAGGTAAAGG
AAGAGTCTACGTGCATTGTTCAGCCGGACTGGGAAGAGCTCCAGGGGTTTCGATTGCTTATATGTATTGGTTCTGCGACA
TGAACCTTAACACGGCTTATGACAATTTGGTATCAAAGCGTCCATGTGGGCCTAACAAAGGAGCCATCCGCGGCGCAACA
TATGATCTGGCTAAGAACGATCCCTGGAAAGAGCCCTTTGAGAGTCTCCCTGAGAACGCATTCGAGGACATTGCCGATTG
GGAAAGGAAGTTGATTCAAGAACGTGTTCGGGCCCTCCGTGGAACCTGA