Details for Lyrate rockcress Locus 16060447

Position : sca3 ( 5`- 12186278 .. 12185554 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479992 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16060447

Protein [Map View]
MSYLLKTLTKKEEIDRIIRDTIDEVLVLRFGRFSDDVCLQHDEILAKSVRDVSKFAKVALVDVDSEEVQVYVKYFDITLF
PSTIFFFNAHHMKLDSGTADHTKWIGAFHIKQDFINVVEAIYRGAMKGKMIVQCPIPPERIPKYQLLYKDV*

DNA
ATGAGTTATCTTTTGAAGACGTTAACGAAGAAGGAAGAGATTGATCGGATCATCAGAGACACCATTGATGAAGTTCTTGT
TTTACGATTTGGTCGTTTCTCTGACGACGTTTGTCTTCAGCATGACGAAATTCTTGCGAAATCGGTGAGAGATGTTTCGA
AATTTGCAAAAGTAGCTTTGGTTGATGTTGATTCAGAGGAAGTTCAAGTGTATGTGAAGTATTTTGACATTACTTTGTTT
CCTTCGACGATCTTCTTCTTCAATGCGCATCATATGAAATTGGACTCTGGAACTGCGGATCATACTAAATGGATTGGTGC
ATTTCACATAAAACAGGACTTTATTAATGTTGTTGAGGCAATATATCGAGGAGCGATGAAAGGGAAGATGATTGTTCAAT
GTCCGATACCGCCGGAGAGGATACCAAAGTATCAACTCTTGTACAAGGATGTGTAG