Details for Lyrate rockcress Locus 16060433

Position : sca3 ( 5`- 7258099 .. 7256740 -3` )
Annotation : [B2G] universal stress protein family protein
External links : CoGe
PGDD synteny : 16060433

Protein [Map View]
MAESGGRRIGVAVDFSECSKKALSWAIDNVVRDGDHLILITIANDMNYEEGEMQLWETVGSPFIPLSEFSDAAVMKKYAV
KPDAETLDIVNTAARKKTVTVVMKIYWGDPREKICAAAEQIPLSSLVMGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK
AHT*

DNA
ATGGCGGAGAGTGGTGGACGGAGGATCGGAGTGGCGGTGGATTTCTCGGAGTGTAGCAAGAAGGCTCTGAGCTGGGCGAT
AGATAACGTGGTTCGCGACGGAGATCATCTAATCCTAATCACCATCGCTAACGATATGAATTACGAGGAAGGCGAGATGC
AGCTCTGGGAGACTGTTGGATCACCTTTTATTCCTCTGAGTGAATTCTCTGATGCTGCTGTGATGAAGAAGTATGCAGTG
AAGCCAGATGCTGAAACTCTTGACATTGTCAACACTGCCGCTAGGAAGAAAACGGTTACAGTAGTGATGAAGATATATTG
GGGAGATCCTCGTGAGAAGATTTGTGCAGCAGCTGAACAGATTCCTCTCTCAAGCCTTGTGATGGGTAACAGAGGCCTTG
GTGGTCTTAAGAGGATGATTATGGGAAGTGTAAGCAACCATGTGGTCAACAACGTTGCATGCCCTGTGACCGTTGTCAAG
GCTCACACCTGA