Details for Lyrate rockcress Locus 16060357

Position : sca3 ( 5`- 5043372 .. 5044551 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478618 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16060357

Protein [Map View]
MCDLVARTGRLQQRYEDGSRLVAGCIPFRYINSDKDGNSESGKVIQVLMISSSSGPGLLFPKGGWENDETVREAAVREAV
EEAGVRGILMDFLGNYEFKSKTHQDEFSPEGLCKAAMYALYVKEELETWPEHETRTRKWLTIEEAVENCRHAWMKDALVE
GFCKWHKEKMDKGEEITSEH*

DNA
ATGTGTGATTTGGTCGCGCGTACGGGTCGGCTCCAGCAGCGGTACGAGGATGGCTCTCGTCTCGTAGCCGGGTGTATTCC
ATTTAGGTATATAAATTCTGACAAAGATGGTAATTCTGAATCTGGGAAAGTGATTCAAGTGTTGATGATCAGCTCGTCTA
GTGGACCGGGACTTTTGTTTCCCAAGGGAGGATGGGAGAATGATGAGACAGTCAGGGAGGCTGCAGTGAGGGAAGCAGTG
GAAGAAGCAGGTGTCCGTGGGATTCTAATGGATTTTTTGGGAAATTATGAGTTCAAGAGCAAAACACACCAAGATGAGTT
TAGCCCAGAAGGTTTATGTAAAGCGGCAATGTACGCATTGTATGTGAAGGAAGAGCTAGAGACGTGGCCGGAACATGAGA
CGAGAACACGGAAATGGCTGACAATTGAAGAAGCGGTAGAGAATTGCAGGCACGCTTGGATGAAGGATGCATTGGTTGAA
GGATTCTGTAAATGGCATAAGGAGAAGATGGATAAAGGAGAGGAGATAACAAGTGAACATTGA