Details for Lyrate rockcress Locus 16060350

Position : sca3 ( 5`- 5016381 .. 5019160 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060350

Protein [Map View]
MQLVDVKQSLEAVMNNKLSDFEKSLYKKLKSGKLEVKVSYRTFLCPYCPDNKKKVGLYVDILQHASGVGNSKSKKRSLTE
KASHRALAKYLIKDLAHYATSTISKRLKARTSLTPAEGGDTPLVYDDDQFEKLVWPWKGVLVNIPTTITQDGRSCTGESG
PKLRDELIRRGFNPIRVRTVWDRFGHSGTGIVEFNRDWNGLHDALVFKKAYEADGHGKKDWLCGATDSRLYAWLANVDDY
YRATYLGEKLRKTGDLKSISRFAEEEARKDQKLLQRLNVMVETKQNRLKKLEIKYSQDSIRLKYETQEKEKILHGYNADL
TGRQQKSTDHFNRIFADHEKQKVQLESQIKELEIRELELAKREAENETQRKIVAKELEQNAAIFSYAQLAAVEQQKTREK
VQRLAVDHKMQKEKLHKRIAALERQLDQKQELELEVEQLKRQLSVMRHVELDSGSEIVNKVETFLRDLSETEGELAHLNK
FNQDLVVQERKSNDELQEARRALISNLRDMRSHIGVRRMGELDTKPFMEAMRKKYCQEDLEDWAVEVIQLWEEYLKDPDW
HPFKRIKLETAETVVEVIDEDDEKLRTLKNELGDDAYQAVANALLEINEYNPSGRYISSELWNFREDRKATLEEGVTCLL
EQWNQAKHHKP*

DNA
ATGCAGCTCGTAGATGTAAAACAATCACTGGAGGCGGTGATGAACAACAAATTGAGTGATTTTGAGAAAAGTTTGTACAA
AAAACTCAAGAGTGGAAAGCTCGAGGTGAAAGTCTCCTACCGGACTTTCCTGTGTCCCTATTGCCCCGATAACAAGAAGA
AGGTTGGTTTGTATGTTGACATCCTTCAACATGCTTCTGGAGTTGGTAATAGCAAATCCAAGAAAAGAAGTTTGACTGAG
AAGGCAAGCCACCGTGCTCTTGCCAAATACCTTATTAAAGATCTTGCACATTACGCTACAAGTACAATATCTAAGCGCTT
AAAAGCCAGAACATCACTCACTCCTGCTGAAGGCGGCGATACTCCTCTAGTTTATGATGATGATCAATTCGAGAAACTTG
TGTGGCCTTGGAAAGGCGTTTTGGTTAATATTCCCACGACGATTACACAAGATGGTCGGTCTTGTACTGGAGAGAGTGGT
CCAAAACTTAGAGATGAATTAATCCGAAGAGGATTCAACCCAATTAGAGTTCGTACTGTGTGGGACCGTTTCGGTCATTC
AGGAACCGGGATAGTGGAATTTAACAGAGATTGGAACGGACTTCACGATGCTTTGGTGTTCAAGAAAGCCTATGAAGCAG
ATGGTCATGGGAAAAAGGATTGGCTGTGTGGTGCTACTGACTCGAGACTTTATGCATGGCTTGCCAATGTTGATGATTAC
TATAGGGCTACCTATTTAGGAGAAAAATTGCGGAAGACGGGTGACCTCAAAAGTATTTCTAGGTTTGCAGAAGAAGAGGC
AAGGAAAGACCAAAAGCTTTTGCAGCGTCTGAACGTAATGGTTGAGACCAAACAAAATCGGTTGAAAAAGTTAGAGATAA
AATATTCACAGGATTCAATTCGACTTAAGTATGAGACTCAAGAAAAAGAAAAGATTCTCCATGGTTACAATGCAGATCTG
ACAGGAAGACAACAAAAATCGACTGATCACTTCAATAGGATTTTTGCTGATCATGAAAAGCAAAAGGTGCAGCTGGAGTC
TCAGATAAAGGAACTTGAAATTAGAGAGTTGGAGTTGGCAAAACGTGAGGCAGAGAATGAAACACAGAGGAAAATAGTGG
CAAAAGAGCTTGAACAGAATGCTGCTATTTTTAGTTACGCTCAACTAGCTGCCGTGGAACAACAAAAGACCAGAGAGAAA
GTGCAAAGATTGGCTGTAGATCACAAGATGCAAAAGGAAAAGCTTCATAAGAGAATTGCTGCACTAGAAAGGCAGCTTGA
TCAGAAGCAGGAGCTCGAACTGGAGGTCGAGCAACTGAAAAGGCAGCTGAGCGTGATGAGACACGTGGAATTGGACAGTG
GTTCTGAAATTGTGAACAAGGTGGAGACCTTCCTCAGAGACCTTAGTGAGACGGAAGGAGAGCTTGCACACTTAAATAAA
TTTAATCAAGATCTTGTTGTTCAAGAGCGGAAGAGCAATGATGAGCTTCAAGAAGCTCGAAGAGCATTGATAAGTAATTT
GAGGGACATGAGATCGCATATTGGTGTTAGGAGAATGGGGGAGCTTGACACCAAACCGTTTATGGAAGCAATGAGAAAAA
AGTACTGTCAAGAAGATTTAGAGGATTGGGCAGTTGAAGTTATCCAGCTTTGGGAGGAATATCTTAAGGACCCAGATTGG
CATCCTTTTAAACGGATAAAGCTTGAGACTGCAGAAACAGTAGTGGAAGTAATAGATGAGGATGACGAGAAGTTAAGAAC
CCTGAAGAATGAACTGGGGGATGATGCGTACCAAGCAGTGGCAAATGCATTGCTGGAAATAAACGAGTATAATCCAAGTG
GAAGGTACATCTCCTCAGAGCTATGGAACTTTAGAGAAGACAGGAAGGCTACGCTTGAGGAAGGTGTTACTTGTCTACTG
GAGCAATGGAATCAGGCGAAGCATCACAAGCCTTAA