Details for Lyrate rockcress Locus 16060346

Position : sca3 ( 5`- 1061742 .. 1061587 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060346

Protein [Map View]
MHDDDVYIKLLKDICNKLMKVTLCCGRLVGYVFLYVAHERLLMCPLQILEP*

DNA
ATGCATGATGATGATGTATATATAAAACTGCTGAAAGATATATGCAATAAATTAATGAAAGTAACCTTATGTTGTGGACG
TCTCGTAGGCTATGTCTTCCTCTACGTGGCACATGAGAGGTTGCTCATGTGTCCCCTTCAAATACTTGAGCCGTAG