Details for Lyrate rockcress Locus 16060305

Position : sca3 ( 5`- 7888389 .. 7886307 -3` )
Annotation : [B2G] sequence-specific dna binding protein
External links : CoGe
PGDD synteny : 16060305

Protein [Map View]
MGRPPSNGGPAFRFILPEVTEMEAILLQHNTAMPGRHILEALADKFSESPERKGKIVVQFKQIWNWFQNRRYALRARGNK
APGKLNVSSMPRMDLPNQMRNVVQPLAVPKTTHMTGNLPGMTPAPSGILVPGVMRSGSDNSYLEFEAKSARDGAWYDVQA
FLAHRNLEIGDPEVQVRFAGFEVEEDEWINVKKHVRQRSLPCEASECVAVLAGDLVLCFQEGKDQALYFDAIVLDAQRRR
HDVRGCRCRFLVRYSHDQSEQEIVPLRKICRRPETDYRLQQLHNAVNDLANSNQHQIPALDAAAKTPLSQSGATVPIVAS
KPKDPSLSATPATLVQPSSNAATVPAGSA*

DNA
ATGGGTCGACCTCCCAGTAATGGCGGTCCGGCGTTTCGATTTATCCTGCCCGAGGTAACGGAGATGGAAGCAATTTTGCT
ACAGCATAATACAGCAATGCCAGGTCGACATATTCTTGAAGCTCTTGCTGATAAGTTTAGTGAATCACCTGAGCGGAAGG
GGAAAATTGTTGTGCAATTCAAGCAAATCTGGAACTGGTTTCAAAATAGGCGATATGCTTTAAGAGCAAGGGGAAATAAA
GCTCCTGGGAAGCTAAATGTATCTTCCATGCCGCGTATGGATTTACCAAATCAGATGAGGAATGTGGTTCAACCATTAGC
CGTTCCTAAAACCACTCATATGACTGGAAATTTACCCGGCATGACGCCTGCCCCTTCCGGTATTTTAGTTCCTGGTGTCA
TGAGGAGTGGTTCAGACAACTCTTACTTAGAATTTGAAGCCAAATCTGCCAGGGATGGTGCTTGGTATGATGTGCAAGCT
TTCCTAGCTCATAGAAACTTGGAGATTGGTGATCCGGAAGTGCAGGTTCGATTTGCGGGTTTCGAAGTTGAAGAAGATGA
ATGGATAAATGTGAAAAAGCACGTAAGACAACGGTCTCTCCCATGTGAAGCATCAGAATGTGTTGCAGTTCTTGCCGGAG
ATCTCGTACTTTGTTTCCAGGAAGGAAAAGATCAAGCTCTTTACTTTGATGCCATTGTTCTTGACGCACAAAGAAGAAGA
CATGATGTCAGAGGTTGTCGTTGTAGGTTCTTGGTGCGTTACAGCCACGACCAGTCCGAGCAGGAAATTGTTCCCTTGAG
GAAGATTTGTCGGCGGCCCGAGACAGATTACAGGCTACAACAACTTCACAATGCTGTAAACGATTTGGCTAACTCGAATC
AGCATCAGATACCCGCTCTAGATGCGGCTGCGAAAACCCCTCTTTCACAATCTGGAGCTACAGTTCCCATTGTTGCATCC
AAGCCAAAAGATCCGAGCCTGAGCGCCACTCCAGCCACTTTGGTTCAGCCTAGCTCCAATGCAGCCACTGTCCCCGCTGG
TTCTGCCTAG