Details for Lyrate rockcress Locus 16060263

Position : sca3 ( 5`- 3843547 .. 3841430 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060263

Protein [Map View]
MVKKAKWLKNVKKAFSPDSKKLKHESVECQDSVISYPVLIATSRSSPPQFEVRVDEVNYEQKKNLCPPSSVSVTPTVAHV
LVDSPPSSPESVHQAIVDDRFAGKSKEDAAAILIQSTFRGNLSLSLSCVMRGQARLKLLMEGSVVQRQAAITLKCMQTLS
RVQSQIRSRRIRMSEENQARHKQLLQKHAKELGGLKNGGNWNDSNQSKEQVEAGMLHKYEATMRRERALAYAFTHQQNLK
SNSKTANPMFMDPSNPTWGWSWLERWMAGRPWESSEKEQNTTNNNNNENSSVKNSTNRNSHGGETAKSLNRNKLNISTQS
NTPSSSSTATRNPRKKRPIPSPIKSKTSDDEAKSSEKNRRHSTARSSVSDDETLTSSTAKRSNHLIPTTKPVRGKPKPQS
SSRAAVTTTTTEENSVLPEKAPAKKRLSTSASPAPKPRRSSAPPKVEKGALKAERTP*

DNA
ATGGTTAAAAAGGCGAAATGGCTCAAGAACGTTAAGAAGGCTTTTAGCCCAGATTCAAAGAAGTTGAAACATGAATCTGT
TGAGTGTCAAGATAGTGTAATCTCTTACCCTGTCTTGATTGCCACATCCAGAAGTTCTCCTCCTCAGTTTGAAGTTAGAG
TTGATGAGGTCAACTATGAACAGAAGAAGAATCTGTGTCCTCCTTCTTCAGTTTCTGTGACTCCTACTGTTGCACATGTT
CTTGTAGATTCACCTCCATCTTCTCCTGAATCTGTTCATCAAGCTATAGTTGATGATAGGTTTGCAGGCAAGTCAAAGGA
AGATGCAGCTGCCATCTTAATTCAGTCTACGTTTAGGGGCAATTTGTCTTTAAGTCTTTCTTGTGTAATGAGGGGGCAGG
CAAGACTTAAGCTACTGATGGAAGGATCGGTTGTACAACGGCAAGCTGCAATTACTCTGAAATGTATGCAGACCCTCTCT
CGTGTACAGTCACAAATCAGATCTAGAAGAATCAGGATGTCAGAAGAGAATCAGGCTCGACATAAGCAACTTCTTCAGAA
GCATGCCAAAGAGCTAGGAGGCTTAAAGAATGGGGGTAATTGGAACGACAGCAATCAGTCGAAGGAACAGGTTGAAGCGG
GTATGTTGCACAAGTACGAGGCGACAATGAGAAGGGAAAGGGCATTGGCATATGCATTCACACATCAGCAAAATTTGAAG
AGCAACTCGAAAACTGCAAATCCGATGTTCATGGATCCCAGCAACCCGACTTGGGGTTGGAGCTGGTTAGAGAGGTGGAT
GGCTGGCCGGCCATGGGAGAGTTCAGAGAAAGAACAAAACACAACCAACAACAACAACAACGAAAACTCCTCGGTCAAGA
ACTCGACTAACCGTAATTCCCATGGAGGAGAAACCGCAAAATCTTTGAACCGCAACAAACTCAATATCTCGACTCAATCC
AATACCCCATCATCATCATCCACTGCCACCAGAAACCCGAGAAAGAAGAGGCCAATTCCATCGCCCATAAAATCCAAAAC
CAGTGATGATGAGGCCAAGAGCTCGGAGAAGAACCGTAGGCACAGCACTGCAAGGTCATCAGTTAGTGATGACGAGACCC
TGACTAGCTCAACAGCTAAACGTAGTAACCATCTGATTCCCACCACAAAACCAGTACGAGGCAAGCCCAAGCCCCAGAGC
TCATCACGTGCAGCGGTGACCACAACCACAACGGAGGAAAACAGTGTATTACCGGAGAAAGCACCAGCAAAGAAACGGCT
CTCCACCTCGGCTTCACCTGCACCCAAACCCAGACGATCCTCAGCCCCACCAAAGGTGGAAAAAGGCGCTCTCAAAGCAG
AGAGAACGCCGTGA