Details for Lyrate rockcress Locus 16060244

Position : sca3 ( 5`- 596546 .. 593925 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896208 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16060244

Protein [Map View]
MAEGGEDPQRLKKIAAAAFDYENDARWADYWSNILIPPHMASRPEVVDHFKRKFYQRYIDPDLVVEPMSTSSSSSQSARP
SATSASSNANEQVRSRNSGSVPRTSGPSATTGANPSSMRWDQQTIQFSVNAWVFVIAVLAVLPLIPKNLSNRAYRLSFMG
TACSSLYSLYSLYGRPRAWNMQGLQIYFQSIVAAKDFIYFIYCLTFVTSHLCLKFALIPILCRALEQVAKFLRRNFGRST
IYRKYLEDPCVWVESNTTTLNILSSQAEIAIGFLLIISLLSWQRNIIQTFMYWQLLKLMYQAPVTAGYHQSTWSKIGRTV
TPIIQRYAPFLNTPVSAVQRWWFR*

DNA
ATGGCGGAAGGCGGCGAAGATCCCCAGCGGTTGAAGAAAATTGCGGCGGCTGCCTTCGACTACGAAAACGACGCTCGATG
GGCTGATTACTGGTCCAATATCCTCATCCCTCCTCACATGGCTTCTCGTCCCGAGGTCGTCGACCATTTCAAGCGCAAAT
TCTACCAACGCTACATCGATCCTGATCTTGTTGTGGAGCCTATGTCGACTTCATCTTCGTCTTCACAATCTGCCAGACCA
TCTGCTACATCTGCATCTTCTAATGCAAATGAACAAGTTCGTTCACGGAACTCAGGATCGGTTCCTCGAACCTCTGGGCC
ATCTGCTACGACAGGTGCAAACCCAAGTTCAATGCGCTGGGATCAGCAGACGATTCAGTTTTCAGTCAATGCTTGGGTTT
TTGTTATAGCTGTGCTGGCAGTGCTACCACTAATACCAAAGAACCTCTCAAATAGGGCTTATCGTCTATCTTTCATGGGA
ACTGCGTGCTCATCTCTATATTCCTTATACTCCTTATACGGGAGGCCAAGGGCATGGAATATGCAAGGGCTACAAATTTA
TTTTCAGTCAATTGTGGCAGCAAAGGATTTCATCTATTTCATCTACTGCCTTACATTCGTCACTTCACATCTCTGTCTCA
AGTTTGCTTTGATTCCCATCTTGTGCCGGGCACTTGAACAAGTAGCCAAGTTCTTGAGGCGTAACTTTGGTCGGTCCACT
ATATACAGAAAGTACTTGGAAGACCCTTGTGTGTGGGTGGAGTCAAACACTACTACCCTCAACATCCTGTCATCGCAGGC
TGAGATAGCCATTGGCTTCCTTCTGATCATATCTCTACTCTCATGGCAACGCAACATTATACAGACGTTCATGTACTGGC
AGCTATTGAAGCTGATGTATCAAGCACCGGTAACAGCGGGTTACCACCAGAGCACATGGAGCAAAATCGGGAGGACAGTG
ACTCCGATTATCCAACGTTACGCTCCCTTCTTGAACACTCCGGTGAGTGCCGTTCAGAGATGGTGGTTCAGGTGA