Details for Lyrate rockcress Locus 16060229

Position : sca3 ( 5`- 7933191 .. 7933477 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060229

Protein [Map View]
LSSMTWGYARIIAGTLLGGTLGFYVMHRIEVSYKMRMEEALNQYEKDMLKRQEEENLSQIN

DNA
TTGAGCTCAATGACATGGGGTTACGCACGGATCATAGCTGGAACACTTCTCGGCGGGACTCTCGGATTCTACGTAATGCA
TCGCATCGAAGTTAGCTACAAGATGAGGATGGAGGAAGCGTTGAATCAATACGAGAAGGATATGCTGAAGAGACAAGAAG
AAGAGAATCTTAGTCAGATCAATGA