Details for Lyrate rockcress Locus 16060211

Position : sca1 ( 5`- 7760359 .. 7761534 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_472067 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16060211

Protein [Map View]
MSSRENPSGICKNIPNLISSFVDTFVDYSVSGIFLPQDPSPQNDILQTRFDKPERLVAVGDLHGDLDKSREAFKIAGLID
SSDRWTGGSTMVVQVGDVLDRGGEELKILYFLEKLKREAERAGGKVLTMNGNHEIMNIEGDFRYVTKTGLEEFQVWADWY
CLGNKMKTLCSGLDKPKDPYEGIPMSFPRMRADCFDGIRARIAALRPEGPISKRFLTKNQTVAVVGDSVFVHGGLLAEHI
EYGLERINEEVRGWINGLKGGRYAPVYCRGGNSVVWLRKFSEEMAHKCDCAALEHALSTIPGVKRMIMGHTIQDAGINGV
CNDKAIRIDVGMSKGCADGLPEVLEIRRDLGVRILTSNPLYKENPYSHLAPDSKTGLGLLVPVPKQVEVKA*

DNA
ATGTCAAGCAGAGAAAACCCTAGCGGAATCTGCAAGAACATTCCCAATCTCATCTCTTCTTTCGTCGACACTTTCGTTGA
TTACTCCGTCTCCGGCATCTTCTTGCCTCAAGATCCTAGCCCACAGAATGATATTCTGCAAACGAGGTTCGACAAACCGG
AGCGACTCGTTGCAGTCGGCGATCTCCATGGCGATCTCGACAAGTCTAGAGAAGCATTCAAGATCGCTGGTCTGATTGAT
TCGTCGGACCGATGGACTGGTGGATCCACCATGGTTGTTCAGGTGGGAGACGTACTGGATCGAGGAGGAGAGGAGTTAAA
GATTCTTTATTTCTTAGAGAAATTGAAACGAGAGGCTGAGAGAGCTGGAGGTAAGGTTCTGACTATGAATGGCAACCATG
AGATCATGAATATAGAAGGTGACTTTAGATATGTGACCAAGACGGGTTTAGAGGAATTTCAGGTTTGGGCTGATTGGTAT
TGTTTAGGGAACAAGATGAAGACTTTATGCAGTGGTCTTGATAAACCTAAGGATCCTTATGAAGGGATTCCGATGAGCTT
CCCTCGTATGAGAGCCGACTGTTTTGACGGAATTAGAGCTAGGATTGCTGCATTGAGACCTGAAGGTCCGATTTCAAAGA
GATTCTTGACTAAGAATCAAACAGTTGCTGTTGTTGGTGATTCGGTGTTTGTTCACGGTGGACTTTTAGCTGAGCACATA
GAGTATGGACTGGAGAGGATAAACGAGGAGGTTAGGGGTTGGATTAACGGGTTGAAAGGAGGACGATATGCACCTGTGTA
TTGTAGAGGAGGAAACTCTGTAGTTTGGTTGAGGAAATTCTCGGAAGAGATGGCTCACAAATGTGATTGTGCAGCTCTTG
AGCATGCTCTTTCCACTATTCCCGGGGTTAAGAGGATGATCATGGGACACACAATCCAGGATGCTGGTATCAACGGTGTT
TGTAATGATAAAGCCATTAGGATCGATGTGGGCATGTCCAAGGGATGTGCTGACGGACTGCCTGAGGTTTTGGAAATCCG
CAGGGACTTGGGTGTGCGGATATTGACATCGAATCCATTGTATAAGGAGAACCCGTATTCTCATTTAGCTCCTGATAGTA
AAACGGGTCTCGGGTTGCTGGTACCAGTTCCTAAGCAAGTGGAAGTCAAAGCTTGA