Details for Lyrate rockcress Locus 16060189

Position : sca3 ( 5`- 8083245 .. 8083838 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060189

Protein [Map View]
MADYDDEIDHNNQPFIPKETALQALNSIIQLHFEKTLEKKRAIDHQKKKLHKLFQLFFIFLAVIFFSLSQPSGRLHCRHC
WAPICLLSFSHLFFYVSVAQTLRCINGFKYQRRCHKLTLGLATHKLRFIKSRIAAGDFLGGGDGDEASAAAWDLEVPYQE
PPDSYFGKFKRNWALYFGFLILLYTFMISFSVVILCF*

DNA
ATGGCGGACTACGACGACGAAATTGACCACAATAACCAACCTTTCATCCCCAAAGAAACCGCTCTACAAGCCCTAAACTC
AATAATCCAGCTCCACTTCGAGAAAACCTTAGAGAAAAAACGTGCCATTGACCACCAGAAGAAGAAGCTCCACAAGCTAT
TTCAGCTCTTCTTCATCTTCCTCGCCGTGATCTTCTTCTCTCTATCACAACCCTCAGGTCGTCTCCACTGCCGCCATTGC
TGGGCACCCATCTGCCTCCTCTCCTTCTCCCACCTCTTCTTCTACGTCTCCGTCGCTCAAACTCTCCGTTGCATCAACGG
CTTCAAGTACCAGCGTCGCTGCCACAAGCTCACTCTCGGCCTCGCCACTCATAAGCTCCGTTTCATCAAGTCAAGAATCG
CCGCCGGAGATTTCCTCGGTGGTGGCGACGGTGACGAGGCCTCGGCTGCTGCTTGGGATCTGGAAGTTCCGTATCAAGAA
CCACCAGATAGCTACTTTGGCAAGTTTAAGAGAAATTGGGCTCTGTATTTTGGGTTCTTGATCCTTCTTTACACTTTCAT
GATCTCTTTCTCTGTCGTTATCCTCTGTTTCTGA