Details for Lyrate rockcress Locus 16060186

Position : sca3 ( 5`- 2252032 .. 2252664 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060186

Protein [Map View]
MSSEQGNGSNSSTSPEVEGTKTIPFRRRMQRAQRVLAPKLMEALRRSRISSEEAPAIHLSRRWRATTAQKVYSLKLYDAL
QRSRRSATVRDTADKVLATTARGVTRWSRAILVSRFGTSLRRRRNTKPAWAMAAAVRGSGGRRRRKVSAVGSRVRVLGGL
VPGCRRTALPELLDETADYIAALEMQVRAMTALSKILSEFQPSTKLGSAL*

DNA
ATGTCTTCTGAACAAGGAAATGGATCGAATTCTTCCACGTCGCCGGAGGTAGAAGGGACTAAAACAATCCCTTTTCGCCG
GAGAATGCAAAGAGCACAAAGAGTGTTGGCTCCAAAGCTGATGGAGGCTCTCCGTCGATCAAGGATAAGCTCGGAAGAAG
CTCCGGCGATCCATCTTAGTCGTAGATGGAGAGCCACAACGGCGCAGAAGGTATATTCCTTAAAGCTCTACGATGCTCTT
CAGCGATCGCGGCGCAGCGCAACAGTCCGGGACACGGCCGACAAAGTCCTTGCGACGACGGCTCGGGGTGTAACTCGGTG
GAGCCGAGCCATATTGGTGAGTCGATTCGGGACGAGTCTGAGGCGGCGCAGGAATACAAAACCGGCGTGGGCAATGGCAG
CGGCGGTCAGGGGAAGCGGTGGGAGGAGGAGGAGGAAGGTGTCGGCGGTGGGAAGTCGGGTCCGGGTTTTGGGTGGGTTG
GTGCCGGGTTGCCGGAGAACGGCCTTACCGGAGCTTTTGGATGAGACAGCAGATTACATAGCGGCGTTGGAAATGCAAGT
CCGAGCCATGACAGCTCTATCAAAGATTCTGTCTGAGTTTCAGCCGTCTACTAAACTCGGCTCGGCTTTATAG