Details for Lyrate rockcress Locus 16060164

Position : sca3 ( 5`- 7343486 .. 7344068 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060164

Protein [Map View]
MAEAKGAVVKHVLLAKFKDGVSPETIEELIKGYANLVNLIEPMKAFHWGEDVSIENLHQGYTHIFESTFETKEAVAEYIA
HPAHVEFATIFLGSLDKALVIDYKPTSVSL*

DNA
ATGGCGGAAGCTAAGGGAGCGGTGGTGAAGCACGTATTGCTTGCTAAGTTCAAAGATGGCGTAAGCCCTGAGACAATCGA
AGAGCTTATCAAAGGTTACGCCAATCTCGTCAATCTCATCGAACCTATGAAAGCTTTCCACTGGGGAGAAGATGTGAGCA
TTGAGAATCTGCATCAAGGTTACACACACATCTTTGAATCCACATTTGAGACCAAAGAAGCTGTTGCAGAGTACATTGCT
CATCCTGCTCACGTTGAATTCGCCACCATCTTTCTTGGCAGCTTGGATAAAGCATTGGTTATTGACTACAAGCCTACCTC
TGTCTCTCTCTAA