Details for Lyrate rockcress Locus 16060130

Position : sca3 ( 5`- 2449334 .. 2445114 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_317476 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16060130

Protein [Map View]
MNMKTSKMKFTKEMIESIKDKLPRLSFLLLFLRQCYGGCGDRTHLLPCSIATTSTRFWNLSDRPVELQIRVGSILKRVHT
LKPGRSKRLRHRSIHRAYVDDQEGRRWLYYDDTCLPYVWVHETGTDLSKMVKQQYVSLEDLRDYSEIRVFKDLQRGCVSV
EKRDRASAFLSASSCSAFCLISFFPIVILSPMGISFSNNNRRRDNNNNRRHLHHYPPPPYYYLDPPPPPPPPFPPHYDYN
YSNYHLSQPLPPQPQINSCSYGHYHYHHQPPQYFTTAQPNWWGPMVRPAYYGPPQPQAQTQPLPPPFVEQQNAKKVRNDV
NVHRDTVRLGVDDLVPGHHLVSFVFDALFDGSFTITFFAKEEPNCTIIPQFPEVYSPTRFHFQKGPGQKFLQPSGTGTDL
SFFALDDLSRPLQEDVYPLVISAETVISPNSISEQSSVHKQVTQAVLEKDNDGSFKVKVVKQILWIEGVRYELRELYGST
TQGAASGLEDSGSGKECVICMTEAKDTAVLPCRHLCMCSDCAKELRLQSNKCPICRQPIEELLEIKVNSSDEQH*

DNA
ATGAATATGAAAACATCAAAGATGAAGTTCACAAAAGAGATGATAGAGTCTATCAAAGACAAGCTCCCAAGACTCAGCTT
CCTCCTCCTCTTCCTCCGACAATGCTACGGTGGCTGCGGCGACCGGACCCACTTACTCCCTTGCTCCATCGCCACCACTT
CCACCCGCTTTTGGAACCTCTCCGACCGTCCCGTGGAGCTCCAAATTCGGGTCGGTTCAATCCTAAAACGGGTCCACACT
CTCAAACCTGGCCGTTCCAAGAGGCTTAGACACAGAAGCATCCACAGAGCTTACGTGGATGATCAGGAAGGACGTAGATG
GCTGTACTACGACGACACGTGCCTACCGTACGTATGGGTGCACGAGACCGGTACAGACTTGTCGAAGATGGTGAAGCAAC
AGTACGTGAGTCTCGAGGATCTGAGGGATTACTCGGAGATTAGGGTTTTTAAGGATTTACAGAGAGGTTGTGTCTCAGTT
GAGAAAAGAGACAGAGCTTCTGCTTTTCTCTCTGCTTCTTCCTGTTCTGCTTTCTGTCTTATCTCTTTCTTTCCCATTGT
CATTCTCTCACCAATGGGAATCTCCTTTAGCAACAACAACAGAAGACGAGACAACAATAACAATCGCCGTCACCTCCACC
ACTATCCTCCACCGCCTTACTATTACCTCGACCCTCCTCCTCCTCCGCCGCCGCCATTTCCACCACATTATGACTATAAC
TACTCCAATTACCATCTCTCTCAACCTCTACCGCCACAACCACAGATCAACTCTTGTTCCTACGGCCATTACCATTATCA
CCATCAGCCTCCTCAGTATTTCACCACCGCTCAGCCCAATTGGTGGGGTCCAATGGTGAGGCCGGCGTATTACGGTCCCC
CTCAGCCGCAAGCGCAAACGCAACCGCTTCCACCGCCATTCGTGGAGCAACAGAACGCGAAGAAGGTGAGGAACGATGTC
AATGTGCATAGAGATACAGTGAGGCTTGGAGTGGACGATCTCGTCCCTGGTCACCATCTAGTTTCCTTCGTCTTCGATGC
CCTTTTCGATGGCAGTTTCACTATCACCTTCTTTGCAAAGGAGGAACCAAATTGCACCATTATCCCGCAGTTTCCAGAGG
TTTATTCACCGACAAGATTTCATTTTCAGAAAGGTCCTGGACAGAAGTTTCTGCAGCCTTCAGGGACAGGAACAGACCTG
AGCTTCTTCGCTCTTGACGATCTGTCAAGACCTTTACAAGAAGATGTGTATCCGCTTGTAATATCAGCTGAGACGGTAAT
CTCTCCTAATTCGATCTCAGAGCAATCATCAGTTCATAAGCAAGTCACACAAGCGGTTCTCGAGAAAGATAATGATGGAT
CTTTCAAAGTGAAAGTGGTGAAGCAGATTCTTTGGATTGAAGGAGTTCGATATGAACTCCGTGAGTTGTATGGCTCGACC
ACTCAAGGTGCAGCCTCGGGATTAGAGGACAGTGGTTCGGGTAAAGAATGTGTGATCTGCATGACTGAGGCTAAGGACAC
GGCTGTACTGCCTTGCAGACATTTGTGCATGTGTAGCGACTGTGCTAAAGAATTGAGGCTTCAGTCGAACAAATGTCCGA
TTTGTCGACAACCCATCGAAGAGCTCTTAGAGATCAAAGTGAACAGTAGTGATGAACAACACTAG