Details for Lyrate rockcress Locus 16060103

Position : sca3 ( 5`- 3385713 .. 3388716 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060103

Protein [Map View]
MKSTHHHRAPLISASSSSSSSSQNHSFVSRLLLLLTLLPVSLACLAFILQWRGGGLADPSSASVRSSTSVPGGSDLNHEV
FPGMETVSSVSPKSHQSSSDCSNLARSSSPSFPYYGDWKFGVDTSLKPKICITTSTSAGLDQILPWMFYHKVLGVSTFFL
FVEGKAATPSISKVLESIPGVKVIYRTKELEEKQAKSRIWNETWLSSFFYKPCNYELFVKQSLNMEMAIVMARDAGMDWI
LHLDTDELIYPAGAREYSLRRLLLDVPPNVDMVIFPNYESSVERDDIKDPFTEVSMFKKNYDHLPKDTYFGMYKEATRNN
PNYFLTYGNGKSVARVQDHLRPNGAHRWHNYMKTPNEIKLEEAAVLHYTYARFSDLTSRRDRCGCKPTKEDVKRCFMLDF
DRSAFIIASTATEEEMLSWYREHVVWGDKEVKTKLIRKGILTRIYSPMVVIQALKESGVFSSVVSSVSTNLSKKKFLSSI
HKSNSSRSTASESLPSKENKSEGISARHLLGDESAIPPLSPPGMEHARFVTED*

DNA
ATGAAATCGACACACCATCACAGAGCTCCACTAATTTCTGCTTCTTCCTCATCTTCATCTTCTTCCCAAAACCATTCTTT
CGTCTCTAGGCTCCTCCTTCTCCTTACTTTACTTCCAGTTTCCCTTGCTTGTCTCGCCTTTATCCTCCAATGGCGAGGCG
GTGGTCTCGCCGATCCTTCCTCTGCTTCTGTTCGTTCATCTACGTCGGTTCCTGGCGGCTCCGATCTCAATCACGAGGTG
TTTCCCGGCATGGAGACTGTTTCTTCTGTCTCCCCAAAGTCTCACCAATCGTCTTCCGACTGCTCAAATCTAGCTCGCAG
CTCTTCTCCTTCCTTTCCTTACTATGGTGATTGGAAGTTTGGTGTTGATACTAGTTTAAAGCCTAAGATATGTATAACGA
CTAGCACATCAGCTGGATTGGATCAGATTCTACCATGGATGTTCTACCATAAGGTTCTAGGAGTCTCTACATTCTTCCTT
TTCGTAGAAGGGAAAGCTGCTACTCCGAGTATTTCTAAAGTGCTGGAGTCTATTCCTGGGGTTAAAGTAATATACAGGAC
GAAAGAGCTTGAGGAGAAGCAAGCAAAGAGCCGGATTTGGAATGAGACGTGGCTATCGTCTTTCTTTTATAAGCCCTGCA
ATTATGAGTTATTTGTCAAACAATCTCTCAACATGGAAATGGCTATTGTCATGGCAAGGGATGCGGGCATGGATTGGATA
CTTCATCTTGACACAGATGAGCTAATATACCCAGCAGGTGCTCGTGAGTACTCACTCAGACGGTTGCTGCTTGATGTTCC
TCCAAATGTGGATATGGTTATATTTCCAAATTACGAAAGCAGCGTAGAAAGAGATGATATCAAGGATCCTTTTACAGAGG
TGTCAATGTTCAAGAAGAATTATGATCATCTTCCAAAAGATACATATTTTGGAATGTACAAAGAAGCAACACGAAATAAT
CCAAATTACTTCTTGACTTATGGTAACGGCAAATCAGTTGCTCGGGTTCAAGATCACCTTCGTCCAAATGGAGCACACAG
ATGGCATAATTACATGAAAACTCCCAATGAGATCAAATTGGAGGAGGCTGCTGTCCTACACTACACATATGCAAGATTTT
CTGACTTAACATCCAGGCGTGATCGATGTGGCTGCAAGCCTACAAAAGAAGACGTGAAAAGATGCTTTATGTTGGACTTT
GATAGATCTGCATTTATAATTGCGTCAACAGCAACTGAAGAAGAAATGCTAAGCTGGTACCGTGAACACGTTGTGTGGGG
CGACAAAGAGGTGAAGACGAAACTCATTAGGAAGGGTATTCTGACTCGCATCTATTCACCAATGGTTGTTATACAAGCAT
TGAAAGAATCTGGTGTCTTTAGCTCGGTTGTCTCATCAGTGTCTACAAATCTTTCAAAGAAAAAGTTCTTATCATCAATT
CACAAAAGCAACTCATCCAGGTCTACTGCATCTGAGTCCCTTCCATCAAAGGAAAACAAGTCTGAGGGCATCTCTGCAAG
GCACCTTCTTGGGGATGAATCAGCCATCCCTCCTTTATCGCCACCTGGGATGGAACACGCTAGATTTGTCACAGAGGATT
AA