Details for Lyrate rockcress Locus 16060086

Position : sca3 ( 5`- 3468007 .. 3470966 -3` )
Annotation : [B2G] vhs domain-containing protein
External links : CoGe
PGDD synteny : 16060086

Protein [Map View]
MVHPLVDRATSDMLIGPDWAMNLEICDMLNHEPGQTREVVSGIKKRLTSRTSKVQLLALTLLETIINNCGELIHMQVAEK
DILHKMVKMAKRKPNIQVKEKILILIDTWQESFSGPQGRHPQYYAAYQELLRAGIAFPQRPQTTPSSGQTGPSTTYPQNS
RNTRQEAIDTSTESEFPTLSLTEIQNARGIMDVLAEMMNAIDGNNKEGLKQEVVVDLVSQCRTYKQRVVHLVNSTSDESM
LCQGLALNDDLQRLLAKHEVIASGNSMIIKEDKSKKEVPKHTTQIIDVGSSETKDGSVVASTTNGPKIDLLSGDDFETPD
ADISLALVPLGPPQPSSPIAKPDNSIVLIDMLSDNNCESSTPTSNPHANHQMVQQHYSNGFGPGHQEQSYYGQGSSAPVW
NLQITQQHQQPSSPAYGNQPFSPNFSPPASPHYGGQNNNVLALPPPPWEAQSPSSSPQYSPTHPMQVTQVVITTHTHQPL
GYNPQGGSPHATNNNNNLFGMFLPPIAGGHMPPFGHNPNVTNNNYNPIMYGGYGGHAQPPQQYLVEQQMYGMSLQENGNN
NTNPYQVSSHQPPPMNKKPEDKLFGDLVELSKFKKPTSGRAGSM*

DNA
ATGGTGCATCCTTTGGTTGATAGAGCCACAAGCGATATGCTCATTGGTCCTGATTGGGCCATGAACCTCGAGATATGTGA
CATGCTTAATCATGAGCCTGGGCAAACGAGAGAGGTAGTGAGTGGCATAAAGAAGAGGCTTACCAGTAGGACTTCCAAGG
TCCAGCTTTTGGCTCTTACATTACTAGAGACAATAATAAACAATTGTGGGGAACTTATTCATATGCAAGTTGCAGAGAAG
GATATACTTCATAAGATGGTGAAGATGGCCAAAAGGAAGCCTAACATCCAAGTGAAGGAGAAGATATTGATACTTATAGA
TACTTGGCAAGAGAGCTTTTCAGGTCCACAAGGAAGGCATCCACAATATTACGCAGCATACCAAGAATTGTTGCGTGCAG
GAATTGCATTCCCTCAAAGACCTCAAACCACACCCAGTTCAGGACAAACTGGTCCTTCGACAACGTATCCTCAGAATTCT
CGTAACACTAGACAAGAAGCTATTGATACTTCAACAGAATCAGAATTTCCAACTTTGAGTTTGACAGAAATTCAAAACGC
AAGAGGAATTATGGATGTCTTAGCTGAAATGATGAACGCAATAGATGGAAACAACAAAGAGGGACTTAAACAAGAGGTTG
TTGTAGATCTTGTTAGCCAATGTCGCACCTATAAACAAAGAGTAGTACATCTTGTAAACTCGACATCAGATGAATCTATG
CTTTGCCAAGGCCTAGCCTTAAATGACGATTTGCAGCGATTACTTGCAAAGCACGAAGTCATCGCCTCTGGAAACAGTAT
GATAATAAAGGAAGACAAATCTAAAAAAGAAGTTCCCAAGCACACAACTCAGATCATAGATGTTGGTTCAAGTGAGACCA
AAGATGGTAGTGTTGTGGCTTCTACAACCAATGGTCCAAAAATAGACCTTCTAAGTGGTGATGACTTCGAGACTCCGGAT
GCGGACATCTCATTAGCTCTTGTTCCCCTCGGACCTCCACAACCAAGTAGTCCCATAGCAAAGCCAGACAATTCCATCGT
CTTAATTGATATGTTATCAGATAATAACTGTGAAAGCTCTACTCCAACTTCGAATCCACACGCAAATCATCAGATGGTGC
AACAACATTACTCGAATGGATTTGGACCTGGCCATCAAGAGCAATCTTATTATGGACAAGGGTCATCTGCGCCTGTTTGG
AATCTCCAAATTACTCAACAACACCAACAACCATCTTCTCCTGCCTACGGAAACCAACCCTTTTCGCCTAACTTTAGCCC
GCCTGCCTCTCCTCACTATGGTGGACAAAACAACAACGTTCTAGCATTACCTCCACCACCATGGGAAGCTCAATCTCCAA
GCTCTAGCCCTCAATACTCTCCAACTCATCCAATGCAAGTGACTCAAGTGGTCATCACCACACACACTCATCAACCCCTC
GGTTACAACCCTCAAGGCGGCTCTCCTCATGCTACGAACAACAACAATAACTTGTTCGGAATGTTCCTCCCTCCAATAGC
AGGAGGCCATATGCCACCCTTTGGCCACAACCCAAACGTCACAAACAACAATTACAATCCCATTATGTACGGAGGCTATG
GAGGACATGCTCAGCCACCACAACAGTATCTTGTAGAACAACAAATGTACGGAATGTCTCTTCAAGAGAATGGAAACAAC
AACACTAATCCCTACCAAGTTTCTTCTCATCAGCCTCCACCAATGAATAAGAAACCAGAAGACAAGTTGTTTGGTGATCT
TGTTGAGCTCTCCAAGTTCAAGAAACCCACTTCAGGACGAGCCGGTAGTATGTAA