Details for Lyrate rockcress Locus 16060057

Position : sca3 ( 5`- 10734836 .. 10733306 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16060057

Protein [Map View]
MAASSTFSSLLPSPPALLSDHRSPPSSIRFSFSSLTVPKSSRLGFTVSERRNLAANSSLVEVSIGGERDPPPPSGSGGDD
KGIALLKLKLLSVVSGLNRGLVASVDDLQRAEVAAKELETAGGPVDLTDDLDKLQGKWRLLYSSAFSSRSLGGSRPGLPT
GRLIPVTLGQVFQRIDVFSKDFDNIAEVELGAPWPFPPLEATATLAHKFELLGTCKIKITFEKTTVKTSGNLSQIPPFDI
PRLPDSFRPSSNPGTGDFEVTYVDDNLRITRGDRGELRVFVIA*

DNA
ATGGCGGCTTCTTCTACTTTCTCGTCACTACTACCTTCACCACCGGCTCTTCTTTCCGACCACCGCTCTCCTCCTTCATC
CATCAGATTCTCTTTTTCCTCCTTAACTGTTCCAAAATCGTCTCGTTTGGGTTTTACTGTATCAGAGAGGAGAAATCTCG
CGGCGAATTCGTCTCTCGTTGAGGTATCTATCGGCGGAGAACGCGACCCACCACCACCATCTGGATCGGGTGGAGACGAC
AAGGGAATTGCATTACTCAAACTCAAATTACTTAGTGTAGTTTCGGGATTAAACAGAGGACTTGTGGCGAGTGTTGATGA
TTTACAAAGAGCTGAAGTGGCTGCTAAGGAACTTGAAACCGCTGGTGGACCGGTTGATTTAACCGATGATCTTGATAAGC
TTCAAGGGAAATGGAGGCTTTTGTATAGTAGCGCCTTCTCGTCTCGGTCTTTAGGTGGTAGCCGTCCTGGACTACCCACT
GGACGTTTGATCCCTGTGACTCTTGGCCAGGTGTTTCAACGGATTGATGTGTTTAGCAAAGATTTCGATAACATAGCAGA
GGTGGAATTAGGAGCTCCTTGGCCATTTCCGCCATTAGAAGCCACTGCTACATTGGCTCACAAATTTGAACTCTTAGGCA
CTTGCAAGATCAAGATAACATTTGAGAAAACAACTGTTAAGACATCAGGAAACTTATCGCAGATTCCTCCGTTTGATATC
CCAAGGCTTCCCGACAGTTTCCGGCCATCGTCAAACCCTGGAACTGGGGATTTCGAAGTCACCTATGTTGATGATAACTT
GCGTATAACTCGCGGGGACAGAGGTGAACTTAGGGTATTCGTCATTGCTTAA