Details for Lyrate rockcress Locus 16060034

Position : sca3 ( 5`- 5192766 .. 5190762 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478657 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16060034

Protein [Map View]
MHQYGSTGQHCEFTAASYFSWPTSSRLSNAAEERANYFSNLQKEEEEDEEVSPEPASTDPKGQRATTLLELMTIRAFHSK
ILRCYSLGTAIGFRIRRGVLTDIPAIIVFVSRKVHKQWLSPLQCLPTALEGAGGIWCDVDVVEFSYFGEPDHQPTPKQTF
TTDIVDHLQGSDPFIGSGSQVASQETCGTLGAIVRSQTGSRQVGFVTNRHVAVNLDYPSQKMFHPLPPALGPGVYLGAVE
RATSFITDDLWFGIFAGTNPETFVRADGAFIPFADDYDLSRVTTSVKGGVGEIGEVKAIELQSPVGSLVGKQVVKVGRSS
GLTTGTVLAYALEYNDEKGVCFLTDFLVVGENHRSPFDLEGDSGSLIVMKGEEKARPIGIIWGGTGSRGRLKLKVGECPE
SWTTGVDLGRLLTHLQLDLITTDEGLKAAVQEQRAASTTGMSSMVADSSPPYVNLKKGKRNPEEKVEASLGPLQVQHIDL
EERIETKGGAPSVEHQFMPTFSGQCSASAWPETAREDLAVGLTNGSCDGDLCVGLRLGDDGAKRRRTQVTKERMRPAE*

DNA
ATGCATCAGTATGGGTCAACGGGTCAACACTGCGAGTTCACGGCGGCGTCTTACTTCTCCTGGCCGACTTCAAGCAGGCT
GAGCAACGCGGCGGAGGAAAGAGCTAACTATTTCTCAAACTTGCAGAAAGAGGAGGAGGAGGATGAGGAGGTTTCTCCTG
AACCAGCTTCCACAGACCCTAAAGGGCAACGAGCCACTACTTTGCTTGAGCTCATGACTATAAGAGCTTTCCACAGCAAG
ATCTTGCGTTGTTATAGTCTTGGAACAGCTATAGGGTTCAGGATCCGGAGAGGGGTTCTTACTGATATCCCGGCGATTAT
TGTCTTTGTGTCTCGGAAAGTGCATAAGCAATGGCTAAGTCCTCTTCAGTGTCTTCCTACTGCTCTTGAGGGAGCAGGAG
GGATTTGGTGTGATGTGGATGTGGTGGAGTTTTCTTATTTTGGAGAACCTGATCATCAGCCCACACCTAAACAAACATTC
ACTACTGACATTGTTGATCATCTCCAAGGTTCTGACCCTTTCATTGGATCAGGCTCTCAGGTGGCAAGCCAAGAGACTTG
TGGGACTTTGGGGGCAATAGTGAGGAGTCAGACTGGAAGTAGACAAGTTGGTTTTGTGACTAACCGCCATGTTGCTGTCA
ACTTAGATTACCCGAGCCAGAAGATGTTTCATCCTCTCCCTCCTGCCCTCGGTCCCGGTGTCTATCTTGGAGCAGTTGAG
AGAGCCACTTCCTTCATCACAGACGATCTCTGGTTTGGCATTTTTGCTGGCACCAATCCAGAGACGTTTGTGAGAGCAGA
TGGTGCATTCATCCCCTTTGCAGACGACTATGACTTGTCACGAGTTACAACGTCTGTCAAAGGTGGAGTTGGAGAGATTG
GTGAGGTCAAAGCCATAGAGTTGCAGTCTCCAGTTGGCAGTTTAGTGGGTAAACAGGTGGTGAAAGTCGGGAGAAGCTCT
GGTTTGACTACTGGAACTGTGCTGGCTTACGCGCTGGAGTACAATGACGAGAAAGGAGTCTGCTTCCTCACTGATTTTCT
TGTTGTTGGGGAGAACCATCGCAGTCCATTTGATCTTGAGGGAGACAGCGGAAGCCTTATAGTGATGAAAGGAGAAGAGA
AGGCAAGACCCATTGGGATCATATGGGGAGGCACTGGAAGCCGCGGGAGGCTGAAACTGAAGGTGGGGGAGTGTCCAGAG
AGCTGGACCACTGGTGTAGATCTGGGGAGGCTTCTTACACATCTTCAGCTTGATCTCATCACCACCGATGAAGGGTTAAA
AGCGGCAGTGCAAGAACAACGAGCGGCCTCAACAACGGGGATGAGCTCAATGGTTGCAGACTCGTCACCTCCATATGTGA
ATCTCAAGAAAGGGAAGAGAAACCCGGAAGAGAAGGTAGAGGCATCATTAGGACCTCTTCAGGTCCAACACATTGATCTT
GAAGAGAGAATAGAAACAAAAGGAGGTGCTCCAAGTGTAGAACACCAGTTCATGCCAACCTTCAGCGGTCAATGTTCCGC
ATCTGCTTGGCCTGAAACTGCTAGAGAGGATCTTGCTGTCGGCCTTACAAATGGTAGCTGCGATGGGGATTTATGTGTTG
GACTGCGTTTAGGGGACGATGGAGCTAAACGCAGACGCACTCAAGTGACCAAGGAAAGAATGAGACCAGCCGAATAG