Details for Lyrate rockcress Locus 16060025

Position : sca3 ( 5`- 7579500 .. 7583712 -3` )
Annotation : [B2G] kinase family protein
External links : CoGe
PGDD synteny : 16060025

Protein [Map View]
MEDSSSIDSILEFLRKNRFMRAEAALISELSNNPSSNGCLQKLNFEDNGVSKLLDKTKQRGSSQALGFQKDSHISDELVV
KEIQCGAANNLRESNLMNDVSVQTQSGNADFWEERFMFSEGFEDTGLDLPPWNHTSTDIVADSEVYSINPSKRGFVNPQS
SKKSSHEKVPETGKSNEVVVEDIFSPFEKIRTGSSSQVSQYDSGKACQSLEVDNKVGNSAIQEGFVTTSWSRSEENIGAS
PDHWKDCSVTTVFPLSKGSTSTEDNSVAILDKRQGKKKVGTSDSRILNKEQEDDVATALYLGKSQSGYEHNNLSSLAFSL
PHDGPREDLPRLPHVKIKSEDKPMNFTWEEKHERDILDEKLINTENYFLIGSYLDVPIGQEINSSGGKMAGGGNWLSVSH
GIADDASDLIFGFGDGLGALNEHSNEYWDSDEYDDDDDVGYIRQPIEDEAWFLGHEVDYPCDNEKGTERGSVPDTQDKSQ
TKNDDDHSFAEEDSYFSGEQYVLAKGIEPVTASNDPMGLSMTETYSRTKEPDLLARYEGQLMDAEELSLMHTEPVWKGFV
SHENDLILLNKGKVEDNCNKLCPKDIRAEDDRNAAVRSIGVGMSDDVDDNGSIITEYFPGEGSEWDLELLPYRGVGVAGV
KPPPGKGATMQLKNFASGGFSFPSPVPDRQMSHEDSANPEWSNHCNAVLRNETDESKGLIESDSMVVSLTKRRSGSSSER
NITDMDDEKVASSRNSSPSALSHSSDTGREHKEEDEEETGHGPEEDPGTSFEDEDAIVVQEQVRQIQAQEQDFETFNLKI
VHRKNRTGFEEDKNFHVVLNSVIAGRYHVTEHLGSAAFSKAIQAHDLHTGIDVCVKIIKNNKDFFDQSLDEIKLLKYVNQ
HDPADKYHLLRLYDYFYFREHLLIVCELLKANLYEFQKFNRESGGEVYFTMPRLQSITIQCLEALNFLHGLGLIHCDLKP
ENILIKSYSRCEIKVIDLGSSCFETDHLCSYVQSRSYRAPEVILGLPYDKKIDIWSLGCILAELCTGNVLFQNDSPATLL
ARVIGIIGSIDQEMLAKGRDTCKYFTKNHLLYERNQESNNLEYLIPKKSSLKRRLPMGDQGFIDFVAYLLQVDPKKRPSA
SEALKHPWLTYPYEPISP*

DNA
ATGGAGGACTCGAGCTCTATCGACTCGATTTTGGAGTTTTTGCGGAAGAATCGTTTTATGAGAGCTGAAGCTGCGTTGAT
TAGTGAGCTTTCTAATAACCCAAGTTCAAATGGGTGTCTTCAAAAGCTTAACTTTGAGGATAATGGTGTGAGCAAGTTGT
TGGATAAGACGAAGCAAAGGGGCAGTAGCCAAGCATTAGGCTTTCAAAAGGACAGTCACATTTCTGATGAATTGGTTGTG
AAAGAGATTCAATGTGGAGCTGCCAATAACTTACGCGAGAGTAATCTTATGAACGATGTTTCTGTTCAGACACAAAGTGG
TAATGCAGATTTTTGGGAGGAGAGATTCATGTTTTCTGAAGGATTTGAGGATACCGGGCTTGATTTACCTCCCTGGAACC
ATACTTCTACCGATATTGTAGCTGACTCTGAAGTATACAGTATCAATCCAAGTAAAAGAGGCTTTGTGAATCCACAGAGC
TCAAAGAAATCGAGTCATGAAAAGGTTCCTGAAACTGGTAAAAGCAATGAAGTGGTTGTGGAAGACATCTTCTCTCCTTT
TGAGAAGATACGGACTGGAAGCTCTAGTCAGGTATCTCAGTATGACAGTGGCAAAGCATGTCAATCTCTGGAAGTTGATA
ATAAGGTTGGGAACTCTGCAATACAAGAAGGATTCGTCACCACGTCTTGGTCAAGAAGTGAAGAGAACATTGGTGCTTCA
CCAGACCATTGGAAGGACTGTTCTGTTACAACTGTTTTTCCATTGTCCAAGGGAAGCACGTCAACAGAAGATAATAGTGT
AGCCATTTTAGACAAAAGGCAAGGAAAGAAAAAGGTTGGCACCAGTGATTCCAGGATTCTTAATAAGGAGCAGGAAGATG
ATGTGGCAACAGCGCTATACCTTGGAAAGTCACAGTCTGGTTATGAACATAATAATCTAAGCAGCTTAGCATTTTCGCTG
CCTCATGATGGTCCGAGGGAAGACTTACCTAGACTGCCACATGTAAAAATCAAGTCAGAGGATAAACCGATGAACTTTAC
TTGGGAAGAAAAACATGAGCGAGACATATTGGACGAGAAGCTGATTAATACTGAGAATTATTTCCTTATCGGCTCTTATC
TAGATGTTCCTATTGGACAAGAAATCAATTCATCAGGTGGCAAAATGGCTGGTGGAGGAAACTGGTTGTCTGTAAGTCAC
GGAATAGCAGACGATGCATCTGACTTGATTTTTGGCTTTGGCGATGGATTAGGTGCTCTCAATGAACATTCAAATGAATA
TTGGGACTCTGATGAATATGACGACGATGATGATGTTGGTTACATTAGGCAACCAATTGAGGATGAGGCATGGTTTTTGG
GTCACGAAGTTGACTATCCTTGCGATAATGAAAAAGGCACAGAGCGCGGAAGTGTTCCTGATACGCAGGATAAAAGTCAA
ACCAAGAATGATGATGATCATTCATTTGCCGAGGAGGATTCTTATTTCTCCGGTGAGCAATATGTGCTCGCTAAAGGCAT
TGAGCCAGTTACTGCTTCCAATGATCCGATGGGTCTCTCAATGACTGAAACATACAGCAGGACCAAGGAACCTGATTTGC
TTGCTCGATATGAAGGGCAATTGATGGATGCAGAGGAGCTAAGTTTGATGCACACTGAACCTGTTTGGAAGGGATTTGTC
AGCCATGAAAATGATCTAATTTTGTTGAACAAAGGGAAAGTCGAGGATAACTGTAATAAACTCTGTCCGAAGGATATCCG
CGCAGAAGATGATCGAAATGCTGCAGTTAGGTCAATTGGTGTAGGAATGAGCGATGATGTTGATGACAATGGGAGTATAA
TAACTGAATACTTTCCTGGAGAAGGTAGTGAATGGGATCTGGAGCTCCTTCCTTATCGCGGAGTTGGCGTTGCTGGTGTC
AAGCCTCCACCTGGTAAAGGTGCAACTATGCAGCTTAAAAACTTTGCAAGTGGTGGTTTCTCCTTTCCCTCTCCAGTACC
TGATAGACAGATGTCCCATGAAGATTCTGCAAACCCTGAATGGTCAAACCATTGCAATGCTGTTTTGAGAAATGAAACTG
ATGAATCAAAGGGCCTAATCGAGTCCGATAGTATGGTTGTTTCTTTGACAAAACGACGCAGCGGCTCTTCCTCTGAAAGA
AATATAACAGACATGGATGATGAAAAGGTTGCAAGTTCAAGAAACTCTTCCCCATCCGCACTCTCCCATAGTTCTGATAC
TGGGAGAGAGCACAAGGAAGAAGATGAGGAAGAAACTGGTCATGGGCCGGAAGAAGATCCTGGGACCTCGTTCGAGGATG
AGGATGCAATCGTGGTCCAAGAGCAAGTAAGACAGATTCAAGCCCAAGAGCAGGATTTTGAGACCTTCAACCTGAAGATT
GTTCACAGGAAAAACAGGACTGGTTTTGAGGAGGATAAGAACTTCCATGTGGTTTTGAATTCTGTCATTGCTGGTCGTTA
CCATGTCACTGAGCATCTTGGATCAGCAGCTTTTAGCAAAGCAATACAAGCACATGACCTCCACACCGGCATTGATGTCT
GTGTAAAGATCATAAAGAACAACAAAGACTTTTTTGACCAAAGCCTTGATGAAATCAAACTTCTCAAGTATGTCAACCAG
CATGATCCTGCTGACAAATACCATCTCCTTCGACTGTATGACTACTTCTACTTCCGGGAGCACCTGTTAATAGTATGTGA
ACTTCTCAAGGCAAACTTGTATGAGTTCCAAAAGTTTAATAGGGAATCAGGTGGAGAGGTTTATTTCACTATGCCAAGAT
TGCAGTCAATTACTATCCAGTGCTTGGAAGCATTGAACTTTCTTCATGGTCTGGGCCTTATACACTGCGACTTAAAACCT
GAAAACATACTAATCAAAAGCTACAGCAGATGCGAAATCAAAGTTATTGATCTGGGAAGTAGCTGTTTTGAGACAGATCA
TCTTTGCTCCTATGTTCAGTCTAGATCCTACCGTGCTCCAGAAGTCATTCTTGGGCTTCCATATGATAAGAAGATAGATA
TCTGGTCACTTGGCTGCATTTTGGCTGAACTGTGTACCGGCAATGTTCTTTTCCAAAATGATTCTCCGGCAACTTTGCTT
GCAAGGGTCATCGGTATAATCGGATCCATTGACCAAGAAATGCTTGCCAAAGGACGTGATACATGCAAGTACTTCACCAA
AAATCATTTACTATATGAGAGGAACCAGGAGAGTAACAATTTGGAGTACCTAATACCGAAAAAGTCATCGCTTAAGCGTA
GACTGCCAATGGGTGACCAAGGCTTCATAGACTTTGTGGCATACTTGCTCCAAGTTGATCCAAAGAAACGCCCTTCTGCA
TCTGAAGCTCTTAAGCATCCTTGGTTGACTTATCCCTACGAACCCATATCTCCGTGA