Details for Lyrate rockcress Locus 16060023

Position : sca3 ( 5`- 8773193 .. 8771753 -3` )
Annotation : [B2G] ubiquitin-conjugating enzyme 19
External links : CoGe
PGDD synteny : 16060023

Protein [Map View]
MATVNGYTGNTPAATTPVATGSKQPAPPTKTVDSQSVLKRLQSELMGLMMGGDPGISAFPEEDNIFCWKGTITGSKDTVF
EGTEYRLSLTFSNDYPFKSPKVKFETCCFHPNVDLYGNICLDILQDKWSSAYDVRTILLSIQSLLGEPNISSPLNNQAAQ
LWSNQEEYRKMVEKLYKPLNA*

DNA
ATGGCGACGGTAAATGGGTACACAGGAAATACTCCGGCGGCGACTACGCCGGTAGCCACCGGATCAAAGCAACCTGCTCC
TCCGACTAAGACCGTCGATAGTCAATCTGTCCTCAAAAGGCTGCAATCTGAACTGATGGGCTTGATGATGGGAGGTGATC
CGGGGATATCTGCTTTTCCAGAGGAAGACAACATATTTTGCTGGAAAGGAACAATCACAGGAAGCAAAGATACTGTGTTC
GAAGGAACTGAGTACAGACTCTCACTCACTTTCTCAAACGATTATCCTTTTAAATCTCCCAAAGTTAAGTTTGAGACATG
CTGCTTCCACCCCAATGTGGATCTCTATGGCAACATTTGCTTGGACATTCTTCAGGATAAATGGTCATCTGCTTACGATG
TGAGGACAATATTACTCTCAATTCAGAGCCTTCTTGGAGAACCGAACATCAGCTCACCATTGAACAATCAAGCGGCTCAG
CTTTGGAGCAATCAAGAAGAGTATAGGAAGATGGTTGAGAAGCTGTACAAGCCTTTAAACGCATGA