Details for Lyrate rockcress Locus 16059984

Position : sca3 ( 5`- 3486364 .. 3479796 -3` )
Annotation : [B2G] d-alanine--d-alanine ligase family
External links : CoGe
PGDD synteny : 16059984

Protein [Map View]
MASMATGVSLSMTGGIGGGRGDVERVATAVRTTLKLHQKNSLSESTCSFSVMNKYRGSGGAIRTVSKAVVDGDEMSKNLR
VGLICGGPSAERGISLNSARSVLDHIQGDGISVSCYYIDPDLKAFAISSAQVYSNTPSDFDFKLESLAQGFSSLSKFAEH
LVSAVDIVFPVIHGRFGEDGGIQELLESQNIPFVGTGSRECIRAFDKYEASLELKELGFMTVPNYLVQGTEVDKSEIAQW
FTDNQLDLEMGKVVVKPAKAGSSIGVKVAFGVNDSIKKAIELILEGIDDRVVVEVFIEDAYEFTAIVLDVGSGSGCHPVV
LMPTEVQLQFHGSGDLQENAIFDYRRKYLPTQQVTYHTPPRFPIHVIKSIREEASLIFKKLGLRDFARIDGWYLAPNSNL
SSASETLGGPESGDIIFTDINLISGMEQTSFLFQQASKVGFSHSNILRTVVHRACSRFPHLTWYNYGYSLLLQGSTTLEV
SGDVQKVFVIFGGDTSERQVSVMSGTNVWINLQRFVDLNVTPCLLSPSLGNSSGASLNLDNREVWVLPYSVVLRHTAEEV
LAACLEAVEPDRALFTSLLQKQVMEDLMDGLKNQSWFAGFDITDELPRNFSLKEWIKHAREAQATVFIAGYRYIFMHGGI
GEDGTLQALLEDEGVSYTGPGVLASRTCMDKVMTSQALSHLSELGIHTISKDVRRTEDIMHETIPNVWDELISKFQCLTL
CVKPAKDGCSTGVARLCCSEDLAVYVQALKDCLLRIPPNTLSKTHGTIEMPNPTPEFLIFEPFVETDEIIVSSKVKQQLS
WKGRRRWVEMTVGVIGKRGSMHSLSPSLTVKESGDILSLEEKFQGGTGINLTPPPPTIMSKEALERCKQRIELIAETLGL
EGFSRIDAFVHVETGEVLVIEVNTVPGMTPSTVLIQQALAEQPPMYPPQFFRTLLHLATQRVI*

DNA
ATGGCGTCCATGGCGACCGGTGTCAGTCTTTCGATGACTGGCGGAATAGGAGGAGGAAGAGGCGATGTTGAACGAGTAGC
GACGGCCGTACGGACGACGCTGAAGCTGCATCAGAAGAACTCACTGAGCGAGAGTACATGCAGTTTTTCGGTGATGAACA
AGTATCGGGGATCCGGAGGAGCTATACGAACCGTATCGAAGGCCGTAGTTGACGGAGATGAGATGAGTAAGAATCTGAGA
GTGGGACTCATTTGCGGAGGTCCGTCGGCGGAGCGCGGGATTTCTCTCAATTCTGCTAGATCAGTTCTCGATCATATTCA
GGGTGATGGTATAAGCGTGAGCTGCTATTATATAGATCCTGATCTCAAAGCCTTTGCAATTTCCTCCGCTCAGGTGTACT
CGAATACTCCTTCAGATTTCGATTTCAAGCTGGAGAGTCTTGCACAGGGATTCTCTTCATTATCCAAATTTGCCGAGCAT
CTTGTTTCTGCTGTGGATATAGTTTTTCCAGTAATTCATGGTCGATTTGGTGAAGATGGGGGCATTCAGGAGCTGTTGGA
AAGTCAAAACATTCCATTTGTGGGGACTGGATCCCGTGAATGCATTCGAGCATTTGACAAGTATGAAGCCTCTTTGGAGC
TCAAGGAACTTGGTTTCATGACAGTACCTAACTACTTGGTGCAGGGAACTGAAGTAGACAAAAGTGAAATAGCACAGTGG
TTTACAGATAACCAGCTGGATCTCGAGATGGGAAAAGTCGTGGTAAAACCAGCTAAAGCAGGTTCAAGCATCGGTGTCAA
GGTTGCTTTTGGCGTAAATGATTCAATTAAAAAGGCTATTGAACTTATTCTAGAGGGAATTGATGATAGAGTTGTTGTGG
AGGTGTTTATTGAAGATGCATATGAGTTCACTGCCATCGTCCTTGATGTGGGTTCTGGTTCTGGTTGCCATCCTGTTGTT
TTGATGCCTACTGAGGTGCAACTTCAGTTTCATGGCAGTGGTGATCTACAAGAAAACGCAATCTTCGACTATCGGAGGAA
GTATCTGCCGACACAGCAGGTCACCTATCACACTCCTCCCCGTTTCCCTATCCATGTTATCAAAAGTATTCGTGAAGAGG
CATCTCTTATATTTAAAAAGCTTGGTCTACGTGACTTTGCTCGCATTGATGGATGGTATTTGGCTCCCAATTCAAATTTA
TCATCTGCAAGTGAAACGCTTGGAGGACCCGAGTCAGGGGATATCATATTCACAGACATCAACCTGATAAGTGGCATGGA
GCAAACCAGCTTTCTCTTCCAGCAGGCTTCTAAGGTTGGATTTTCTCATTCAAACATTCTGCGAACAGTTGTCCACCGTG
CTTGCTCGAGGTTTCCCCATCTTACTTGGTATAATTATGGGTATAGTCTATTACTCCAAGGTTCAACAACCCTGGAAGTC
TCTGGGGACGTCCAGAAAGTGTTTGTCATATTTGGAGGAGATACTTCAGAGCGGCAAGTGTCCGTCATGAGTGGAACAAA
TGTCTGGATCAATTTGCAAAGATTTGTAGATCTCAATGTAACTCCCTGTTTGCTTTCCCCCTCACTTGGAAACTCATCAG
GCGCATCTTTGAACTTGGACAACAGAGAAGTCTGGGTTTTGCCCTACTCGGTTGTGCTAAGGCACACTGCTGAGGAAGTT
CTTGCAGCGTGCTTAGAAGCAGTCGAGCCTGATCGGGCTTTATTTACATCTCTCCTGCAGAAGCAAGTGATGGAGGATCT
TATGGATGGTTTGAAGAATCAAAGCTGGTTTGCAGGGTTTGATATCACAGACGAACTGCCCAGAAATTTCTCATTGAAAG
AGTGGATCAAGCATGCCAGGGAAGCTCAAGCAACTGTCTTCATTGCAGGCTATCGCTATATCTTTATGCATGGAGGAATT
GGGGAAGATGGTACACTGCAGGCCTTGCTGGAGGATGAAGGAGTTTCTTATACAGGTCCAGGCGTACTAGCATCAAGGAC
TTGCATGGACAAGGTTATGACATCTCAGGCTCTTAGTCATCTTTCAGAGCTTGGAATTCATACCATAAGCAAAGATGTGA
GGAGAACAGAGGATATAATGCATGAGACCATCCCAAATGTTTGGGATGAATTGATCAGTAAGTTTCAGTGTCTCACACTA
TGTGTTAAACCAGCAAAGGATGGATGTTCCACTGGCGTTGCAAGATTATGTTGCTCTGAAGACCTTGCTGTATATGTACA
AGCTTTGAAAGATTGTCTACTAAGGATTCCTCCAAATACTCTTTCCAAGACACATGGAACGATTGAGATGCCAAATCCTA
CTCCAGAGTTTTTGATTTTTGAACCATTTGTTGAAACCGATGAAATCATAGTTTCATCCAAAGTCAAGCAGCAGCTCTCT
TGGAAAGGTAGGAGGCGGTGGGTAGAGATGACTGTGGGTGTAATCGGAAAGCGTGGGTCAATGCATTCGCTGAGTCCTAG
TCTTACTGTCAAGGAAAGTGGGGATATATTGTCTCTCGAGGAGAAGTTCCAAGGTGGCACTGGCATAAATCTTACTCCAC
CTCCACCCACAATCATGAGTAAGGAAGCTTTGGAGAGATGCAAACAACGCATTGAGCTGATTGCAGAAACTCTCGGGTTA
GAAGGGTTTTCACGGATCGATGCTTTTGTGCACGTTGAAACCGGAGAGGTGCTGGTTATAGAGGTAAACACAGTCCCCGG
AATGACTCCTTCCACTGTTTTAATCCAACAGGCATTAGCAGAGCAGCCGCCAATGTACCCTCCTCAATTCTTTCGCACTC
TGCTCCATCTTGCTACACAGAGAGTCATTTAA