Details for Lyrate rockcress Locus 16059973

Position : sca3 ( 5`- 4164945 .. 4167919 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897221 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16059973

Protein [Map View]
MRALNSRLVLIDINSSWQASRRLISATATAFSSDSSSSFRRTRGARQRISSSKSPASSPSPVRRPSDGFSFDVRSPSADS
SNSASISSRKSPKMAPPTVELDAFLEILPPATRKELVKHEAIEELIEVVMDLGRKPLARFPSGDWVISEQPVTHQDLELA
VSKVGDFSDDNRSGIDRSLHRISAIRNRKLQVIGLTCRVGRVVSGSAEIIRDLIEGGGSILVIGSPGVGKTTLIREIARM
LADEHRKRVVIVDTSNEIGGDGDVPHSGIGRARRMQVPNVNLQHDVMIEAVENHMPETIIIDEIGTELEALAASTIAQRG
VQLVATAHGMTIDNIIKNPSLQILIGGIESVTLGDEEARKRKVQKTILERKGPPTFTCAVEMISRTECRVHQRLDVTVDA
ILAGKSALFEIRQIRGEDDVPHKLVTPIPLERVEEEPAPLLNRDFASEVLSDDEDEDFLPIRYNKASSNTYKSPRSSPVH
VYTYNVLEADLLQVAEVMGLDDEIEVTDDVGEADVILASSSELKQNSSIRRVAKLHKLPIFVIKSTTMAQMVKAVRMILG
RESFGSAPENIEKSYVDDIEIKDDAPESKPSLEELDALEEVRLAIEYIVIPGGEPVELLPRRSDIIVRQLELVESYQLAV
ENLGTHLNPRLQILPRRSTKKTLSSSSPQKAADDSMGTTGTRLPFLKD*

DNA
ATGAGGGCGTTGAACTCGCGGCTAGTTCTAATCGACATCAACAGCTCATGGCAAGCTTCCCGCCGGTTAATCTCAGCCAC
CGCAACCGCTTTTTCATCCGATTCCTCTTCCTCATTCCGTCGAACACGTGGTGCGCGTCAGAGAATCTCTTCATCGAAAT
CTCCGGCGTCGTCACCGTCTCCTGTACGGAGACCATCTGATGGATTCAGTTTCGATGTTCGGTCACCGTCAGCTGATTCG
TCAAACTCTGCGTCGATCTCATCTCGGAAGTCACCGAAGATGGCTCCGCCTACGGTGGAGCTTGACGCTTTCCTCGAGAT
TCTTCCTCCGGCAACGAGGAAGGAGCTAGTTAAGCACGAGGCGATTGAGGAATTGATCGAAGTGGTGATGGATTTAGGGA
GAAAGCCACTTGCTAGATTCCCTTCCGGCGATTGGGTGATCTCAGAGCAGCCTGTGACACACCAGGATCTGGAGCTTGCA
GTATCAAAAGTTGGCGATTTTTCGGATGATAACCGATCGGGGATTGACAGATCCTTGCATCGTATAAGCGCTATACGTAA
TCGCAAACTGCAAGTAATTGGTCTAACATGTCGAGTGGGTCGTGTAGTATCTGGAAGTGCAGAAATTATAAGAGATTTGA
TAGAAGGAGGAGGATCCATCTTGGTCATAGGATCTCCTGGAGTTGGCAAAACAACTTTAATCAGAGAAATCGCACGGATG
TTAGCTGATGAACACAGGAAACGTGTAGTGATTGTTGACACGTCAAATGAGATTGGAGGTGATGGTGATGTTCCTCATTC
TGGAATTGGCCGTGCCAGGCGGATGCAAGTTCCAAATGTGAATTTACAGCACGATGTTATGATTGAGGCCGTTGAGAATC
ATATGCCTGAGACAATCATCATTGACGAGATAGGAACTGAGCTTGAAGCTTTAGCTGCTAGCACTATTGCTCAACGAGGT
GTTCAGCTTGTTGCAACTGCTCATGGGATGACTATAGACAACATAATCAAAAATCCTTCTTTGCAGATTCTTATTGGTGG
AATTGAGAGTGTGACTCTTGGTGATGAAGAAGCAAGGAAAAGAAAAGTGCAGAAGACAATTCTTGAAAGAAAAGGACCTC
CCACATTTACTTGTGCTGTAGAGATGATATCGAGAACTGAGTGTCGTGTTCATCAAAGACTAGATGTCACCGTTGATGCT
ATACTAGCTGGGAAATCCGCTCTATTTGAGATCCGTCAAATTCGTGGCGAAGACGATGTTCCTCATAAGTTAGTGACTCC
CATTCCTTTGGAGAGAGTTGAAGAGGAGCCTGCACCATTGCTCAACAGAGATTTCGCAAGTGAAGTGCTGTCTGACGATG
AAGATGAAGATTTTCTTCCCATTCGGTATAATAAGGCCAGCAGTAACACATACAAGAGCCCAAGAAGCTCACCGGTTCAT
GTTTATACTTACAATGTCCTTGAAGCTGATCTCCTTCAAGTAGCCGAAGTTATGGGCCTAGACGACGAAATAGAAGTGAC
AGATGATGTTGGAGAAGCAGATGTCATACTAGCCTCAAGTTCTGAATTGAAACAAAATTCGTCGATCCGTCGTGTTGCCA
AATTACACAAGCTACCGATATTTGTCATTAAGTCAACTACTATGGCTCAGATGGTGAAGGCAGTCCGAATGATCCTTGGA
AGAGAATCATTTGGCTCTGCCCCTGAAAATATAGAGAAATCTTATGTTGATGATATCGAGATCAAAGATGATGCTCCCGA
GAGCAAACCCAGTTTAGAAGAACTTGATGCCCTCGAGGAAGTCCGTCTAGCAATAGAATATATTGTAATCCCGGGAGGTG
AACCAGTGGAGCTTCTTCCTAGACGGTCAGACATAATAGTTAGGCAGCTAGAGCTGGTGGAGAGTTACCAACTCGCAGTT
GAGAACCTCGGCACTCACCTTAATCCGCGCCTTCAGATTCTTCCTCGCCGATCAACCAAGAAGACGTTGTCATCTTCATC
CCCCCAAAAAGCAGCAGATGATAGCATGGGGACTACGGGTACTCGTCTTCCTTTCCTTAAGGATTGA