Details for Lyrate rockcress Locus 16059970

Position : sca3 ( 5`- 3638731 .. 3637911 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16059970

Protein [Map View]
TVTLRGLALRDMTLGFLVNMSRGSWKNFTRNSSLWRYAFIYFVGEGAADKALQLNGSDMGGWTVDAEALPFPEEDDNFSI
VYLVGKDAVDEAPKLSGTDMGGGHKVVVRFVAYHGRTIVHPRRHKGRIIRGRPREKRNMAEKEEDKKPKFVN*

DNA
ACAGTGACATTGAGAGGATTGGCGTTACGGGATATGACATTGGGCTTCCTCGTGAACATGTCGAGAGGGAGTTGGAAAAA
CTTTACTCGCAATTCTTCTCTCTGGAGGTATGCTTTTATTTATTTTGTGGGAGAAGGCGCAGCAGACAAGGCGTTACAAC
TTAATGGAAGTGACATGGGAGGATGGACTGTCGATGCTGAGGCCTTGCCCTTTCCTGAAGAAGACGACAACTTCTCTATA
GTGTATCTAGTGGGGAAAGACGCAGTAGACGAGGCCCCAAAGCTTAGTGGGACCGACATGGGAGGGGGGCACAAAGTAGT
TGTTCGGTTTGTTGCTTACCATGGAAGAACCATTGTCCACCCCCGCCGCCACAAAGGCCGCATCATTCGTGGCCGCCCAA
GGGAAAAGCGGAATATGGCTGAAAAAGAAGAAGATAAGAAGCCAAAGTTTGTTAATTAA