Details for Lyrate rockcress Locus 16059903

Position : sca3 ( 5`- 12391519 .. 12391941 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16059903

Protein [Map View]
MLQHRTLLCPNRIKFLLSVSKFKRHITQIHAFVITTGNLLNGSSISRDLIASCGLIGEISYARKVLDELPQRSVSVYNSM
IVVYSRGNNPDEVLRLYDQMIAEKVQPDSSTFTMTIKACLSGMALEKGEAVWLKASGIWV*

DNA
ATGTTACAACATCGGACTCTCCTGTGTCCGAATCGCATCAAATTTCTGCTATCCGTTAGTAAATTCAAGCGACACATCAC
TCAGATCCACGCTTTCGTAATTACTACTGGTAATTTACTCAATGGAAGCTCCATTAGTCGCGATCTCATTGCTTCATGTG
GACTAATCGGGGAGATTTCTTATGCACGTAAGGTGCTCGACGAATTGCCTCAGAGAAGTGTTTCTGTTTATAACTCCATG
ATTGTGGTTTATTCTCGTGGAAACAACCCAGATGAGGTTTTACGACTTTATGATCAGATGATTGCTGAAAAGGTCCAACC
AGATAGCTCGACTTTCACTATGACGATCAAAGCGTGTTTGAGTGGTATGGCTTTAGAGAAAGGAGAGGCTGTGTGGCTTA
AAGCCAGTGGAATTTGGGTATAA