Details for Lyrate rockcress Locus 16059826

Position : sca3 ( 5`- 22224614 .. 22225813 -3` )
Annotation : [B2G] zinc finger family protein
External links : CoGe
PGDD synteny : 16059826

Protein [Map View]
MASSSSYRFQSGFCPLSSSPSLGNFVERIKDACHFLVSAVLGTIISAILTFFFALVGTLLGALTGALIGQETESGFIRGA
AIGAISGAVFSIEVFESSLDLWKSDESGFGCFLYLIDVIVSLLSGRLVRERIGPAMLSAVQSQMGAVDAAFDDHTSLFDT
GGSKGLTGELVEKIPKMTITGNNNTDASENRDPCSVCLQDFQLGETVRSLPHCHHMFHLPCIDNWLLRHGSCPMCRRDL*

DNA
ATGGCCTCATCATCATCTTATAGATTCCAATCTGGGTTTTGTCCTCTTTCGTCAAGTCCTTCTCTTGGGAATTTCGTCGA
ACGAATTAAAGACGCTTGTCATTTCCTCGTTTCTGCTGTTCTTGGTACCATTATCTCGGCGATCTTGACCTTCTTCTTCG
CACTAGTGGGCACATTGCTTGGGGCACTTACAGGAGCTTTGATAGGTCAAGAAACTGAGAGTGGTTTCATTAGAGGAGCA
GCAATTGGAGCCATTTCTGGAGCTGTTTTTTCTATTGAGGTCTTTGAATCATCGCTTGATCTCTGGAAATCCGATGAGTC
GGGTTTCGGATGTTTTCTCTACTTGATTGATGTCATTGTTAGTCTTCTAAGCGGGAGACTTGTACGAGAACGCATTGGTC
CTGCAATGCTAAGTGCGGTGCAAAGTCAAATGGGAGCTGTAGATGCAGCCTTTGATGATCACACAAGCCTCTTTGATACA
GGAGGCTCAAAAGGATTAACAGGAGAACTTGTTGAGAAAATCCCAAAGATGACAATCACTGGCAACAATAACACCGATGC
TTCTGAAAACAGAGACCCCTGTTCTGTTTGTCTTCAGGATTTCCAGCTTGGTGAAACAGTTCGAAGCTTGCCTCATTGTC
ATCACATGTTTCACTTACCTTGCATAGACAATTGGCTCCTCAGACACGGTTCTTGCCCGATGTGCAGACGTGACCTTTAA