Details for Lyrate rockcress Locus 16059787

Position : sca1 ( 5`- 7633288 .. 7634549 -3` )
Annotation : [B2G] immunophilin [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16059787

Protein [Map View]
MANLFTATAPFLSLSKPFTKTAPYHQCCASSSNPPEPESSSSSSSSPSPPPPPQPQQKRKKTVETTDWVASSLTRRFGIG
AGLAWAGFLAFGVISEQIKTRIEVSQEVANTRDVEEEKEIVLPNGIRYYDIRVGGGATPRAGDLVVIDLKGQVQGTGQVF
VDTFGSKGKKKPLALVVGSKLYSKGLCEGIDYVLRSMKAGGKRRVIVPPSLGFGEDGAELESGLQIPPNASLEYIVEIDR
VSIAPA*

DNA
ATGGCGAATTTATTCACTGCTACGGCTCCTTTCCTCTCACTCTCAAAGCCGTTCACCAAAACGGCACCGTACCACCAGTG
TTGTGCCTCTTCTTCCAATCCGCCGGAGCCTGAGTCGTCTTCTTCTTCTTCTTCTTCTCCTTCTCCTCCTCCTCCACCTC
AACCGCAACAGAAGAGGAAGAAGACCGTCGAGACGACGGATTGGGTCGCTTCTTCCTTGACTCGGCGGTTCGGAATCGGG
GCTGGTCTTGCCTGGGCGGGCTTTCTGGCTTTTGGTGTAATCTCCGAGCAGATCAAGACTCGGATTGAGGTTTCTCAGGA
AGTAGCTAACACCAGAGATGTAGAAGAAGAGAAAGAGATTGTGTTACCCAACGGCATAAGGTACTATGATATACGGGTTG
GAGGAGGAGCGACACCAAGGGCAGGAGACTTGGTAGTGATTGATCTAAAGGGGCAAGTGCAAGGAACCGGACAAGTATTC
GTGGACACATTTGGAAGCAAAGGCAAGAAGAAGCCATTGGCCCTTGTGGTGGGTTCAAAACTATATAGCAAAGGATTATG
TGAAGGCATAGATTATGTACTAAGGTCCATGAAGGCTGGAGGTAAACGCAGAGTTATTGTTCCACCATCGTTAGGATTTG
GTGAAGACGGTGCTGAATTGGAATCGGGTTTGCAGATTCCTCCGAATGCTTCGTTGGAGTATATAGTTGAGATTGATAGA
GTCTCAATTGCACCTGCTTGA