Details for Lyrate rockcress Locus 16059637

Position : sca3 ( 5`- 3081963 .. 3079573 -3` )
Annotation : [B2G] eukaryotic translation initiation factor 2b family protein
External links : CoGe
PGDD synteny : 16059637

Protein [Map View]
MPDVQSTVVEFVNKLRKRKIEGSQATAKCTVELLRSVISHQRVPHANQAAALIDAVKAVGEQLVAANPVELAVGNVVRRV
LHIIREEDLSLTTAAMGGLDLLDASDDDDVDNCKGIGYPAMSAAVVAAAARSTLRPPSLQTLLEGTPESATVPYTSSSGA
DSESKTADKSSLTRKLKHDVIEGVNQLIHEIAGCHEQIAEQAIEHIHQNEVILTLGSSRTVLEFMCAAKEKKRSFRVFVA
EGAPRYQGHLLAKELVARGLQTTVITDSAVFAMISRVNMVIIGAHAVMANGGVIGPVGVNMAALAAQKHAVPFVVLAGSH
KLCPLYPHNPEVLLNELRSPSELLDFGEFSDCLDFGAGSGSIQVVNPTFDYVPPNLVSLFITDTGGHNPSYMYRLIADYY
SADDLVM*

DNA
ATGCCGGACGTCCAATCAACGGTGGTGGAATTTGTTAACAAGCTCAGAAAACGTAAGATTGAGGGCTCACAAGCTACAGC
CAAATGCACCGTAGAGCTACTTAGGTCAGTGATTTCGCATCAGCGGGTGCCTCACGCAAACCAAGCTGCTGCTCTTATCG
ATGCTGTGAAAGCCGTTGGTGAGCAATTGGTCGCTGCTAATCCTGTTGAGCTTGCGGTGGGAAATGTAGTTAGACGGGTT
TTGCATATTATAAGGGAGGAAGATCTTTCTCTCACTACAGCAGCTATGGGTGGTTTGGACTTGTTGGATGCAAGTGATGA
TGATGATGTAGATAATTGCAAAGGAATTGGGTATCCTGCAATGTCTGCAGCAGTTGTTGCAGCTGCAGCTAGGAGTACGT
TACGCCCTCCATCTTTGCAAACGCTTCTCGAGGGTACTCCTGAATCTGCAACTGTTCCATACACATCTTCATCCGGTGCT
GATTCCGAAAGCAAAACTGCTGATAAAAGTTCATTAACTCGGAAGCTGAAGCATGATGTTATCGAAGGAGTGAATCAACT
TATTCATGAGATTGCTGGTTGTCATGAGCAGATCGCTGAACAAGCTATAGAGCATATACATCAAAATGAGGTGATCCTAA
CCCTGGGTAGCTCAAGAACAGTTCTTGAGTTTATGTGTGCTGCCAAGGAGAAAAAAAGATCTTTTCGTGTATTTGTCGCC
GAAGGTGCTCCAAGGTATCAGGGCCATCTCTTAGCAAAAGAATTGGTAGCTAGAGGTTTGCAGACCACTGTGATCACTGA
TTCTGCAGTGTTTGCGATGATATCACGAGTGAATATGGTTATAATTGGAGCTCATGCAGTGATGGCTAATGGTGGGGTTA
TAGGACCTGTTGGTGTCAATATGGCTGCTCTTGCAGCACAAAAGCACGCAGTCCCATTTGTGGTTCTAGCCGGTAGTCAC
AAGTTGTGTCCACTCTACCCTCACAATCCGGAAGTATTACTAAATGAGCTGAGATCTCCATCCGAACTGCTGGATTTTGG
TGAATTCTCTGATTGCCTGGATTTTGGAGCGGGTTCCGGGTCTATTCAAGTTGTCAACCCAACATTCGATTATGTCCCAC
CAAACCTTGTTAGTCTCTTTATAACGGACACGGGAGGACACAATCCATCCTACATGTACCGTCTTATTGCGGACTATTAC
TCTGCTGATGATTTGGTGATGTAG