Details for Lyrate rockcress Locus 16059624

Position : sca3 ( 5`- 5784239 .. 5781971 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16059624

Protein [Map View]
MLTCIACSNTNNGGSKKQEDDEEDDRVIGTPRSKQAIKSLTSQIKDMAVKASGAYKSCKPCSGSSNQNKNRNYADSDAAS
NSGRFRYAYKRAGSGSSTPKILGKEMESRLKGFLSGEGTPESMSGRTESTVFMEEEDELKEWVAQVEPGVLITFVSLPEG
GNDMKRIRFSREMFDKWQAQKWWAENFDKVMELYNVQQFNQQSVPLPTPPRSEDGSSRIQSTKNGPATPPLNKEGPRGKG
YASSGSIAHQATTQTQSRHQDSSGLATTPKLSSISGTKTETSSVDESARSSFSREEEEEADHSGELSVSNASDIETEWVE
QDEAGVYITIRALPDGTRELRRVRFSREKFGARLWWEQNRARIQQQYL*

DNA
ATGCTGACATGCATAGCTTGTTCGAACACCAACAATGGTGGATCTAAGAAACAAGAAGATGATGAAGAAGACGACAGAGT
TATCGGAACTCCTAGGTCTAAGCAGGCGATTAAGTCCCTGACGTCACAGATTAAAGACATGGCAGTGAAAGCATCAGGTG
CTTACAAAAGCTGCAAACCGTGTTCTGGGTCGTCAAACCAGAATAAGAACCGAAACTACGCTGATTCGGATGCTGCTTCG
AATTCTGGGAGGTTTCGTTATGCGTACAAGAGAGCGGGGAGTGGTAGCTCAACACCGAAAATTTTGGGGAAGGAAATGGA
GTCAAGGTTGAAAGGGTTTTTGAGTGGAGAAGGAACACCTGAATCCATGAGTGGTAGGACAGAGTCCACAGTGTTCATGG
AGGAAGAAGATGAGCTCAAGGAATGGGTTGCTCAAGTGGAGCCTGGTGTCCTCATCACATTTGTATCATTGCCTGAGGGA
GGGAATGATATGAAGCGGATTCGTTTCAGCCGTGAAATGTTCGATAAATGGCAAGCTCAAAAGTGGTGGGCGGAGAATTT
CGACAAGGTCATGGAATTATACAATGTACAGCAGTTCAATCAGCAGAGCGTCCCACTTCCAACTCCTCCTAGATCTGAAG
ATGGGAGCTCGCGAATTCAGTCTACCAAGAACGGTCCTGCAACTCCACCCCTGAACAAAGAAGGCCCTCGAGGAAAAGGC
TACGCTTCTTCTGGCTCAATCGCTCACCAAGCAACAACCCAAACACAAAGTCGACACCAAGATTCATCTGGTCTTGCTAC
AACGCCAAAACTCTCAAGCATAAGTGGAACCAAAACCGAGACATCATCTGTTGATGAGTCTGCAAGAAGTAGCTTCTCGA
GGGAAGAAGAAGAAGAAGCAGATCATTCAGGGGAGCTCTCTGTAAGTAATGCAAGTGACATTGAAACAGAATGGGTGGAA
CAGGACGAAGCCGGTGTTTACATCACAATCAGAGCTTTACCAGATGGGACTCGCGAGCTTAGGCGTGTTCGCTTCAGCCG
AGAGAAGTTTGGGGCAAGATTGTGGTGGGAGCAGAACAGAGCTCGGATACAACAACAATACTTGTGA