Details for Lyrate rockcress Locus 16059592

Position : sca3 ( 5`- 5830880 .. 5833896 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478823 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16059592

Protein [Map View]
MQNPRLKQHQQQQQQQQQALMQQQALMQQHSLYHPGVLAPPQLEPVPSGNLPPGFDPSTCRSVYVGNIHTQVTEPLLQEI
FTSTGPVESSKLIRKDKSSYGFVHYFDRRSAALAILSLNGRHLFGQPIKVNWAYATGQREDTSSHFNIFVGDLSPEVTDA
TLYQSFSVFSSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQTAINEMNGKWLSSRQIRCNWATKGATSGDDKLSSDGKSV
VELTTGSSEDGKETLNEEAPENNSQFTTVYVGNLAPEVTQLDLHRYFHALGAGVIEEVRVQRDKGFGFVRYNTHPEAALA
IQMGNTQPYLFNRQIKCSWGNKPTPPGTASNPLPPPAPAPVPGLSAADLLAYERQLALSKMASVNALMHPQGQHPLRQGA
HGINAAGATAAMYDGGFQNVAAAQQLMYYQ*

DNA
ATGCAGAATCCGAGACTGAAGCAACATCAGCAACAACAACAACAACAACAACAAGCTTTGATGCAGCAACAAGCTCTGAT
GCAGCAACACTCTCTTTACCATCCTGGTGTTTTGGCTCCTCCTCAGTTAGAGCCTGTTCCAAGTGGAAACCTTCCTCCTG
GTTTTGATCCCAGTACTTGCCGTAGCGTGTATGTTGGAAACATTCATACACAGGTCACAGAGCCTCTGCTTCAAGAGATT
TTTACAAGCACTGGCCCTGTTGAAAGCAGTAAACTCATCAGAAAGGATAAGTCATCATATGGATTTGTTCACTACTTTGA
CCGAAGATCTGCTGCTCTGGCTATACTGTCTCTGAACGGAAGGCATCTGTTTGGACAGCCTATCAAAGTCAATTGGGCAT
ATGCCACTGGTCAGAGGGAAGATACATCAAGTCATTTCAACATTTTTGTTGGAGATCTCAGCCCGGAGGTCACTGACGCG
ACATTATATCAAAGCTTTTCTGTCTTTTCCAGTTGTTCGGATGCGAGAGTTATGTGGGACCAAAAAACTGGGCGCTCAAG
AGGCTTTGGGTTTGTTTCCTTCCGCAATCAACAGGATGCTCAAACTGCCATTAATGAGATGAATGGTAAGTGGTTAAGTA
GTAGACAGATCAGATGCAACTGGGCCACGAAGGGCGCTACTTCTGGTGATGATAAGCTCAGTTCTGATGGAAAAAGTGTT
GTAGAACTTACAACTGGGTCATCAGAGGATGGTAAAGAGACATTAAATGAGGAAGCACCTGAAAACAATTCTCAGTTTAC
CACGGTTTATGTGGGAAACCTTGCTCCAGAGGTAACTCAGCTTGATCTACACCGCTACTTCCATGCTCTTGGCGCTGGAG
TTATTGAAGAAGTCCGTGTCCAACGAGACAAAGGCTTTGGTTTTGTGAGATATAACACTCATCCCGAGGCTGCTCTTGCT
ATTCAGATGGGTAACACTCAGCCTTACCTGTTTAACAGACAGATTAAGTGCTCATGGGGAAACAAGCCAACTCCACCAGG
TACAGCCTCAAACCCACTTCCCCCACCTGCCCCAGCACCAGTTCCTGGTCTGTCTGCAGCTGATCTCTTAGCCTATGAGA
GGCAATTGGCACTAAGCAAGATGGCTAGTGTGAATGCGTTAATGCATCCACAGGGTCAGCACCCTCTAAGGCAAGGTGCT
CATGGAATAAATGCCGCTGGAGCTACTGCAGCCATGTACGATGGTGGCTTTCAGAATGTAGCCGCCGCACAGCAGCTCAT
GTACTATCAGTAA