Details for Lyrate rockcress Locus 16059567

Position : sca3 ( 5`- 3265941 .. 3267716 -3` )
Annotation : [B2G] protein binding protein
External links : CoGe
PGDD synteny : 16059567

Protein [Map View]
MGTSSGSNLPHQMLPPRQQLQTSLSLVSSDPHLSRSNSGIVRESPAESASSQETWPTSKSIMGNKTESGKRGPDSHDQLV
IRHVSIADKVSLRDIARERVDIVAERMHRLPEENLDELKNGLKAILEGNGAQPIDEFMFLQKFVQTRSDLTSKTLVRAHR
VQLEILVVINTGIQAFLHPNINLSQSSLIEIFVYKRCRNIACQNELPADGCPCDICANRKGFCNLCMCVICNKFDFAVNT
CRWIGCDVCSHWTHTDCAIRDGEISMGVSPKSVSGMGEMLFKCRACNHTSELLGWVKDVFQHCAPNWDRESLMKELDFVS
RIFRGSEDTKGRKLFWKCEELIDKIKGGLAEATAAKLILMFFQEIELDSPKSLENGEGGGTIAPQDACNRIAEVVKETLR
KMEIVGEEKTRMYKKARMGLEECEREVEEKAKQVAELQMERQKKKQQIEEVERIVRLKQAEAEMFQLKANEAKVEAERLE
RIVKAKKEKTEEEYASNYLKLRLSEAEAEKEYLFEKIKEQESGGNGGEASQAVMYSKIREMLHGYNASSSPRVDPRSNQR
NPFRSNP*

DNA
ATGGGAACATCATCTGGGTCCAATCTTCCTCACCAGATGCTACCTCCACGTCAGCAATTGCAAACATCTCTTTCACTTGT
ATCTTCGGATCCCCACTTGTCACGATCTAATTCTGGCATTGTTCGTGAATCACCAGCTGAAAGTGCTAGCTCTCAAGAAA
CTTGGCCAACCTCAAAATCTATTATGGGAAATAAGACAGAGAGCGGAAAGAGAGGGCCTGACTCTCATGATCAACTTGTC
ATCCGCCATGTTTCCATTGCTGATAAGGTATCGCTACGGGACATAGCTAGGGAAAGAGTTGACATAGTCGCTGAGAGAAT
GCACCGATTACCAGAAGAAAATCTCGACGAGTTAAAGAACGGCCTTAAGGCTATCCTTGAGGGAAATGGTGCCCAGCCTA
TAGATGAGTTTATGTTTCTGCAGAAGTTTGTCCAGACGAGATCTGATTTAACTTCAAAGACACTTGTCAGGGCTCACCGA
GTGCAGCTTGAAATCCTTGTGGTTATAAACACTGGAATCCAAGCATTCTTGCACCCAAACATCAATCTCTCTCAGTCATC
GCTCATCGAGATCTTTGTGTACAAGAGATGCAGAAACATAGCGTGCCAAAACGAACTACCGGCTGATGGTTGTCCCTGTG
ATATATGCGCTAATAGGAAAGGCTTCTGCAACCTGTGCATGTGTGTGATCTGTAACAAGTTTGACTTTGCGGTCAACACA
TGCCGCTGGATTGGCTGCGACGTGTGTTCTCATTGGACTCATACGGATTGTGCTATTAGGGATGGAGAGATTTCGATGGG
AGTTTCTCCCAAGAGCGTATCTGGGATGGGAGAAATGTTGTTCAAGTGTCGAGCCTGCAACCATACTTCTGAATTGCTGG
GGTGGGTTAAAGATGTGTTTCAGCACTGTGCACCAAACTGGGATAGGGAATCTTTGATGAAGGAACTAGACTTCGTGAGT
AGGATTTTCCGTGGAAGCGAAGATACAAAAGGCCGGAAACTATTCTGGAAGTGTGAGGAACTTATTGACAAGATTAAAGG
TGGACTGGCGGAAGCAACAGCTGCCAAGTTGATACTGATGTTTTTCCAAGAAATTGAATTGGACTCTCCAAAGAGCCTTG
AAAACGGAGAAGGTGGGGGAACAATAGCACCTCAAGATGCATGCAACCGAATTGCTGAAGTTGTAAAGGAAACACTGAGG
AAAATGGAGATAGTGGGTGAGGAAAAGACGAGGATGTACAAGAAAGCACGAATGGGGCTTGAGGAATGCGAGAGAGAGGT
GGAAGAGAAAGCAAAGCAAGTGGCGGAACTGCAGATGGAGAGGCAGAAGAAGAAACAACAGATAGAAGAGGTGGAGAGGA
TAGTGAGGCTGAAGCAAGCAGAGGCAGAGATGTTTCAGTTAAAAGCAAACGAAGCAAAAGTGGAAGCAGAGAGATTGGAG
AGGATTGTGAAAGCGAAGAAGGAAAAAACAGAAGAGGAATACGCGAGTAACTACTTGAAACTGAGGCTGAGTGAGGCAGA
GGCAGAGAAAGAGTATCTGTTTGAAAAGATAAAAGAGCAAGAAAGTGGTGGAAATGGTGGTGAGGCGTCACAAGCAGTGA
TGTACTCAAAGATCAGAGAAATGCTTCATGGATACAATGCCTCTTCTTCGCCAAGAGTAGATCCAAGATCTAACCAGCGA
AATCCTTTCAGATCCAATCCTTAG