Details for Lyrate rockcress Locus 16059556

Position : sca3 ( 5`- 12734938 .. 12736483 -3` )
Annotation : [B2G] fk506-binding protein 15 kd-1
External links : CoGe
PGDD synteny : 16059556

Protein [Map View]
MSSASAMKAVGVLLLLTVLTLAYAKKSGDVTELQIGVKYKPQKCDLQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEF
ELGTGQVIPGWDQGLLGACVGEKRKLKIPSKLGYGDNGSPPKIPGGATLIFDTELVAVNGEPASEGKAKNEL*

DNA
ATGAGCTCTGCATCCGCCATGAAAGCTGTTGGAGTTTTGCTTCTGCTTACGGTTCTTACATTAGCTTATGCGAAGAAGTC
AGGTGATGTGACAGAGTTGCAGATTGGTGTCAAGTACAAGCCTCAGAAATGTGATCTTCAGGCTCACAAAGGGGACAAGA
TCAAGGTCCATTATCGGGGAAAGTTAACTGATGGAACTGTCTTTGATTCGAGTTTTGAGAGAGGTGACCCTATTGAGTTT
GAGCTCGGAACTGGTCAAGTCATCCCAGGATGGGACCAGGGTTTACTGGGAGCTTGTGTAGGTGAGAAGAGAAAGTTGAA
AATCCCATCCAAGCTTGGTTATGGTGATAACGGCTCACCACCAAAAATCCCGGGTGGGGCGACATTGATATTTGACACTG
AGCTTGTTGCTGTGAACGGGGAACCAGCCAGCGAAGGAAAAGCAAAGAATGAGCTTTGA