Details for Lyrate rockcress Locus 16059499

Position : sca3 ( 5`- 4890249 .. 4887357 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897419 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16059499

Protein [Map View]
MERSISFNPRGDNELPNDRSSDVGYVANDRRLAYSRSFQQSHGPRTPAVTEAAKPFLDRTVSSIDMPPEIYSVDGNDVFY
GEGKDVEIGKVSVLDMVWEIFGVLRSGNRQMKRLFLLIALNVLYSTTELSIGIFTGRVGLVSDAFHLTFGCGLLTFSLFA
MATSRKKPDHAYSYGYKRLEVLSAFTNALFLMFMSFSLAVEALHAFIQDESEHKHYLIVSAVTNLLVNLLGVWFFRNYAR
VNIAYRKAEDMNYHSVCLHVIADSIRSAGLILASWLLSLGVENAEVLCLGLVSITVFMLVMPLFKATGGVLLQMAPPNIP
SSALSKCLRQITSREDVMEVLQARFWEVVPGHTVGSLRLQVKSGIDERPLLQYVYDVYHDLGVQDLTLQTDYT*

DNA
ATGGAGAGATCCATTTCCTTTAATCCTCGAGGCGATAACGAGCTCCCGAATGATCGCAGCAGTGATGTTGGATATGTTGC
TAATGATCGGAGGCTTGCTTATTCTCGTTCGTTTCAGCAATCTCACGGTCCACGAACGCCGGCGGTCACGGAAGCAGCTA
AGCCTTTTCTCGATAGGACGGTCTCGAGCATCGATATGCCGCCGGAGATTTACTCCGTTGACGGGAATGATGTGTTTTAC
GGGGAAGGGAAAGACGTAGAAATAGGAAAAGTATCTGTTTTGGATATGGTTTGGGAGATTTTTGGAGTACTGAGAAGTGG
AAATCGGCAGATGAAGAGGTTGTTTCTGCTGATTGCGCTTAATGTCTTGTATTCTACAACAGAGCTCTCTATTGGGATCT
TCACTGGGCGTGTAGGTTTGGTCTCCGATGCATTCCATTTGACATTTGGTTGTGGGCTCTTGACATTTTCTTTATTTGCA
ATGGCAACTTCAAGGAAGAAGCCTGATCATGCTTACTCATACGGGTACAAAAGACTTGAAGTTTTATCTGCTTTCACTAA
TGCTCTGTTCCTTATGTTCATGTCATTCTCCTTAGCTGTGGAAGCTCTTCATGCATTTATACAAGATGAATCAGAGCACA
AGCATTATTTGATTGTATCAGCCGTAACAAATTTACTGGTGAACCTACTAGGTGTTTGGTTCTTCCGGAATTATGCTCGT
GTCAATATTGCCTACAGAAAAGCAGAAGATATGAATTACCACTCTGTTTGCTTGCACGTCATAGCAGATTCCATCCGCAG
TGCAGGTCTGATACTGGCATCTTGGCTCCTCTCTCTCGGGGTTGAAAATGCAGAAGTCCTATGTTTAGGATTGGTATCCA
TTACCGTGTTTATGCTTGTTATGCCACTCTTCAAAGCCACTGGTGGTGTCTTGCTTCAGATGGCACCCCCTAACATTCCT
TCTTCAGCATTAAGCAAATGCTTGCGACAGATTACTTCTCGAGAAGATGTCATGGAGGTTTTACAGGCACGTTTCTGGGA
GGTTGTGCCTGGTCACACTGTGGGCTCACTCAGACTCCAGGTGAAGAGCGGAATAGATGAAAGGCCATTACTGCAATATG
TATATGATGTATACCATGATTTGGGTGTACAAGACTTGACCCTGCAAACTGATTACACTTGA