Details for Lyrate rockcress Locus 16059483

Position : sca3 ( 5`- 7918811 .. 7918554 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16059483

Protein [Map View]
MSSVTSSKAQLATSLPLRKLLPPSLRHISGCFLTIPFFGTVGSKTLDHGLFWKIRPLGSGLPDKSAYLTIPSIVKQAFKA
SDPAT*

DNA
ATGAGTTCAGTTACCAGCTCAAAAGCACAGCTCGCAACCTCCCTCCCTTTGCGGAAGCTGTTGCCGCCTTCTCTCAGACA
CATATCAGGATGTTTCCTAACCATCCCCTTTTTCGGTACGGTTGGATCGAAAACTCTTGATCATGGCCTGTTCTGGAAAA
TAAGGCCTCTTGGCTCCGGCCTTCCTGATAAAAGCGCTTACCTTACCATCCCATCGATTGTCAAGCAAGCATTCAAAGCC
AGTGACCCAGCGACGTAG