Details for Lyrate rockcress Locus 16059476

Position : sca3 ( 5`- 6557740 .. 6560559 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16059476

Protein [Map View]
MDDYGITEEDLVIEEAQGYPRAYAKICRDFEVFPYRNGPPFTFMPYILQQNESLRCREVDAMFPVIDPKARPTTKPKIFL
SLLWKQLNHLGNAGFDPAVIRIDPYGNVVYFHADSASPLAWSFDHWFPCSRGGLTVPSNLRIVQWQARKNKKDKLEFLVP
WWDLQVGISVNQFLSIFAASSSDFRRRAFSFLFKEGENEELNGIQMVESHHFPQHFVESKEKFGLASAAVVVSRRDPYDP
SLVLRSLDCNRQTPARKMRFGAAKENETPDLMKNPYQAIVAARDSLRHREEAQNMRAEMKKLDDETNDLTRKNSEDRLSI
QELENELVKRRRRAEKCRRLAEAQCSYRNTLEKMIRDAMHQSVVYKEQVRLNQAASSALMARLEAQKAICDGSEKELHKK
FKEREELENQVRPELEKARKRSRLLLNDEDDLLLDDRDRKLSLYLPGTSEETSSHKELRVHFEEEHKAAASEAEIKKHCE
IEEEEEQKTPEEAEKSLVALEDNKPVEEKLDVEEGKRGSRSFRAFHVFKAPEKEEDEESRRERGKGNVEKWLHILLENNN
KSDPHHLETEKSKKIDEMIEKLDHKFPFLEKVDEEEVDLQLQAKEANNNTSKVSEEEVDLQLQAKEANNNTSKVETRAES
SRRSRMSFDLKNTPEKSGRDKVVKRSESARTFRRIPSSPSLIFGMKKGIDCIRKKPVVSRNDDENEYLVKNNFIKSSLQT
IKRAVKF*

DNA
ATGGACGATTATGGTATAACGGAAGAAGATCTGGTTATCGAGGAAGCACAGGGATATCCGCGAGCTTACGCGAAGATCTG
TCGCGATTTTGAAGTTTTTCCGTACAGAAATGGTCCTCCTTTCACTTTCATGCCCTACATTCTTCAGCAGAACGAGAGCT
TGAGATGCAGAGAAGTAGATGCGATGTTTCCAGTAATTGATCCCAAAGCGAGACCAACAACAAAACCCAAGATTTTCCTC
AGTCTCCTCTGGAAACAGCTTAATCATCTAGGCAATGCTGGATTTGATCCAGCTGTTATTCGGATTGATCCATATGGGAA
TGTTGTTTACTTCCACGCTGATTCAGCTTCTCCTCTTGCTTGGAGTTTTGACCATTGGTTCCCTTGCTCAAGAGGTGGTC
TAACAGTACCAAGCAACCTAAGGATAGTGCAATGGCAAGCACGCAAGAACAAGAAAGACAAGCTTGAGTTCTTAGTACCA
TGGTGGGATCTTCAAGTTGGTATTTCAGTGAATCAGTTCTTGTCGATTTTCGCTGCTTCAAGTTCTGATTTCAGGAGGAG
AGCATTTTCATTCTTGTTCAAAGAAGGCGAAAACGAAGAACTTAACGGTATACAAATGGTTGAGTCACACCATTTTCCAC
AACATTTTGTTGAATCAAAGGAGAAGTTCGGGCTTGCTTCAGCTGCAGTTGTTGTTTCTAGAAGAGATCCTTATGACCCT
TCATTAGTCTTGAGATCACTCGATTGCAATCGACAAACACCTGCAAGGAAGATGAGATTCGGTGCAGCCAAAGAGAATGA
GACTCCAGACTTAATGAAAAATCCGTATCAAGCCATTGTTGCTGCGAGGGACTCATTGAGACACCGAGAGGAAGCGCAGA
ATATGAGAGCCGAGATGAAAAAGTTAGATGATGAAACAAATGATTTGACAAGAAAGAACAGTGAAGATCGGCTTAGTATT
CAGGAGCTAGAGAATGAGCTGGTTAAGCGAAGAAGAAGAGCTGAAAAGTGCAGGAGATTGGCAGAAGCTCAATGCTCGTA
TAGGAATACACTCGAGAAGATGATCCGTGATGCTATGCACCAGAGTGTTGTGTATAAAGAACAAGTGAGGTTAAACCAGG
CTGCGAGTAGTGCGCTTATGGCAAGATTAGAGGCGCAAAAGGCGATTTGTGATGGTTCAGAGAAAGAACTTCACAAGAAG
TTTAAAGAAAGAGAAGAACTGGAGAATCAAGTGAGGCCTGAATTGGAGAAAGCAAGGAAAAGATCAAGACTTTTGCTGAA
TGATGAAGATGACTTGTTGCTAGACGATAGAGACAGGAAGTTATCTCTGTATCTTCCAGGAACAAGTGAGGAAACGTCGT
CACACAAAGAGTTAAGGGTACACTTTGAAGAAGAGCATAAAGCAGCAGCTTCTGAGGCTGAAATTAAGAAGCATTGTGAA
ATAGAGGAGGAAGAGGAACAAAAAACTCCAGAGGAAGCTGAGAAGTCTCTTGTTGCGTTGGAAGATAATAAACCGGTTGA
AGAAAAGCTAGATGTAGAAGAAGGGAAGAGAGGCAGCAGAAGCTTCAGAGCATTCCATGTTTTTAAGGCACCAGAGAAGG
AGGAAGATGAGGAAAGCAGGAGAGAGCGAGGGAAAGGAAATGTTGAGAAATGGCTTCATATTTTACTGGAGAACAATAAC
AAAAGCGATCCACACCATCTTGAAACCGAAAAAAGCAAGAAGATTGATGAGATGATAGAGAAACTGGACCACAAGTTCCC
TTTTCTTGAAAAGGTTGATGAAGAAGAAGTGGACTTGCAGTTGCAGGCTAAGGAAGCAAACAACAACACAAGCAAGGTTA
GTGAAGAAGAAGTGGACTTGCAGTTGCAGGCTAAGGAGGCAAACAACAACACAAGCAAAGTGGAAACAAGAGCTGAAAGT
TCTCGTAGAAGCAGAATGAGTTTTGATTTAAAGAACACACCAGAGAAGAGTGGCAGAGACAAAGTTGTGAAGAGATCAGA
GAGTGCTAGAACCTTCAGAAGGATTCCATCATCTCCATCACTTATCTTCGGAATGAAAAAGGGAATAGACTGCATCAGGA
AGAAGCCAGTGGTTTCAAGAAACGACGATGAGAACGAGTATCTTGTTAAGAACAACTTCATCAAGTCTTCTCTTCAAACA
ATCAAACGAGCTGTCAAATTCTAG