Details for Lyrate rockcress Locus 16059449

Position : sca3 ( 5`- 2035194 .. 2040416 -3` )
Annotation : [B2G] acyl- binding protein acyl- -binding domain 4
External links : CoGe
PGDD synteny : 16059449

Protein [Map View]
MAMPRATSGPAYPKRFYAAASYVGLDGSDSSAKNVSSKFSDDTALLLYALYHQATVGPCNTPKPSAWRPVEQSKWRSWQG
LGTMPSIEAMRLFVKILEEDDPGWYSRASNDIPDPVVDVQINQRTKDEPVVENGNSFGETKTISTENGRLAETQDKDVVS
EDSNTVSVYNQWTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKNWTWSRVETKVATDAQETSTPT
LLAPCAGHSLIAWDNKLLSIGGHTKDPSESMQVKVFDPHTSTWSMLQTYGKPPVSRGGQSVTLVGKTLVIFGGQDAKRSL
LNDLHILDLDTMTWDEIDAVGVSPSPRSDHAAAVHAERYLLIFGGGSHATCFDDLHVLDLQTMEWSRPAQQGDAPTPRAG
HAGVTIGENWFIVGGGDNKSGASESVVLNMSTLSWSVVASVQGRVPLASEGLSLVVSSYNGEDVLVAFGGYNGRYNNEIN
LLKPSHKSTLQTKTLEAPLPGSLSAVNNATTRDIESEVEVSQEGRVREIVMDNVNPGSKVEGNSERIIATIKSEKEELEA
SLNKERMQTLQLRQELGEAELRNTDLYKELQSVRGQLAAEQSRCFKLEVDVAELRQKLQTLETLQKELELLQRQKAASEQ
AAMNAKRQSSGGVWGWLAGSPQEKDDDSP*

DNA
ATGGCTATGCCTAGGGCAACCTCTGGTCCCGCTTACCCGAAGAGGTTCTACGCCGCCGCATCTTACGTCGGTCTCGACGG
ATCTGATTCGTCGGCGAAAAACGTCAGCTCGAAATTTTCCGATGATACTGCACTACTTCTGTATGCGCTGTACCATCAGG
CTACTGTAGGACCATGCAACACTCCGAAACCTAGTGCATGGAGACCAGTGGAGCAAAGCAAATGGAGAAGTTGGCAGGGG
CTCGGAACCATGCCCTCCATTGAGGCAATGCGTCTCTTTGTGAAAATTCTGGAGGAAGATGATCCGGGTTGGTATTCGAG
GGCATCTAATGATATTCCAGATCCTGTCGTAGATGTCCAAATTAATCAGAGAACGAAAGATGAGCCTGTTGTTGAGAATG
GGAACTCATTTGGTGAGACAAAGACAATTTCTACTGAGAATGGACGTTTGGCTGAAACCCAGGATAAAGATGTAGTCTCA
GAAGACTCAAATACTGTTTCTGTATATAACCAGTGGACTGCACCCCAAACATCAGGTCAGCGGCCTAAAGCCCGTTACGA
GCATGGAGCAGCAGTTATTCAAGATAAGATGTATATATATGGTGGAAATCACAATGGCCGTTACCTTGGTGATCTTCATG
TTCTAGATTTAAAAAATTGGACTTGGTCAAGAGTTGAAACCAAGGTTGCAACTGATGCACAGGAAACATCAACTCCAACA
TTATTAGCTCCTTGTGCTGGTCATTCTTTGATAGCATGGGACAACAAGCTGCTTTCTATCGGTGGTCATACAAAGGATCC
CTCAGAATCTATGCAAGTGAAGGTCTTTGATCCCCATACCAGTACATGGTCAATGTTACAGACATATGGAAAACCACCGG
TTTCACGTGGAGGCCAGTCAGTTACATTGGTGGGTAAAACCTTGGTGATATTTGGCGGGCAAGATGCAAAGAGATCACTT
CTGAACGATTTGCATATACTTGACCTAGACACGATGACCTGGGATGAGATAGATGCTGTGGGTGTATCTCCATCTCCGAG
GTCTGATCATGCTGCTGCAGTGCATGCAGAACGTTACCTTCTTATCTTTGGTGGGGGATCACATGCAACCTGTTTCGATG
ACCTGCATGTCCTTGATTTGCAGACTATGGAGTGGTCAAGACCAGCACAACAAGGTGATGCACCAACTCCAAGAGCTGGA
CATGCTGGCGTGACAATTGGGGAGAACTGGTTTATTGTTGGTGGCGGTGATAACAAGAGTGGGGCATCGGAGAGTGTTGT
ACTAAACATGTCAACTCTTTCATGGTCGGTAGTTGCTTCAGTTCAAGGACGTGTACCTCTTGCTAGCGAGGGATTAAGTT
TAGTGGTGAGTTCATACAATGGTGAAGATGTACTAGTCGCTTTTGGTGGATACAATGGACGTTACAACAACGAAATTAAT
CTTCTTAAACCAAGCCACAAATCAACATTGCAAACAAAGACTCTGGAAGCGCCTTTGCCAGGTAGTCTTTCTGCTGTTAA
TAACGCCACGACCAGAGACATTGAGTCTGAGGTTGAGGTGAGCCAAGAAGGCAGAGTACGGGAAATTGTCATGGACAATG
TTAACCCTGGATCAAAGGTTGAAGGAAACAGCGAACGCATTATTGCGACTATTAAATCTGAGAAGGAAGAGCTGGAGGCA
TCACTGAACAAAGAGAGGATGCAGACTCTCCAACTAAGGCAAGAGTTAGGAGAAGCAGAATTACGAAACACAGATTTGTA
CAAGGAACTTCAATCTGTTCGTGGCCAACTTGCAGCCGAACAATCAAGGTGTTTCAAACTGGAGGTTGATGTTGCAGAGC
TAAGACAAAAGCTTCAAACATTGGAAACACTACAAAAGGAACTCGAACTCCTGCAGCGTCAAAAGGCAGCCTCAGAACAA
GCTGCAATGAACGCTAAACGACAGAGCTCGGGTGGCGTATGGGGCTGGCTCGCTGGAAGCCCTCAGGAAAAGGATGATGA
TTCGCCTTGA