Details for Lyrate rockcress Locus 16059395

Position : sca3 ( 5`- 4294355 .. 4290302 -3` )
Annotation : [B2G] ghmp kinase family protein
External links : CoGe
PGDD synteny : 16059395

Protein [Map View]
MSWPTDSELISIKEAVAQMSGRDKGEVRVVVAPYRICPLGAHIDHQGGTVSAMTINKGILLGFVPSGDTQVQLRSAQFEG
EVCFRVDEIQHPIGLANKNGASTPSPSKEKSIWGTYARGAVYALQTSKKNLKQGIVGYLSGSNGLDSSGLSSSAAVGVAY
LLALENANELTVSPTENIEYDRLIENRYLGLRNGILDQSAILLSSYGCLTYMDCKTMDHELVQAPELEKPFKILLAFSGL
RQALTTNPGYNLRVSECQEAAKVLLTASGNSELEPTLCNVEHAVYEAHKHELKPVLAKRAEHYFSENMRVIKGREAWASG
NLEEFGKLISASGLSSIENYECGAEPLIQLYKILLKAPGVYGARFSGAGFRGCCLAFVDAEKAEAAASYVKDEYEKAQPE
FAKNLNGGKPVLICEAGDAARVLL*

DNA
ATGTCTTGGCCTACGGATTCTGAGTTAATTTCCATAAAGGAAGCAGTGGCTCAGATGAGTGGAAGAGATAAAGGAGAAGT
TCGAGTGGTGGTTGCACCTTATCGTATATGTCCTTTAGGAGCTCACATTGATCACCAGGGTGGAACTGTATCAGCTATGA
CGATTAATAAAGGGATCCTTCTTGGTTTTGTTCCATCGGGTGATACTCAGGTCCAGTTGCGTTCTGCACAATTTGAAGGA
GAAGTATGTTTCAGAGTAGATGAAATCCAGCACCCCATAGGCCTAGCAAACAAGAATGGTGCAAGCACCCCATCTCCATC
GAAAGAAAAAAGCATCTGGGGCACTTATGCCAGAGGAGCAGTTTATGCGTTACAGACCAGCAAAAAGAATCTCAAACAGG
GCATTGTTGGTTACCTCAGTGGCTCAAATGGACTAGATAGTTCTGGGCTTAGCTCATCAGCTGCTGTTGGTGTGGCATAC
CTGCTCGCTTTAGAGAATGCAAACGAATTGACTGTATCCCCAACAGAAAATATCGAATATGACAGACTTATTGAGAACAG
ATATCTGGGTCTGCGGAATGGAATTTTGGATCAATCAGCCATTTTGCTTTCGAGTTATGGGTGTCTAACATACATGGACT
GCAAGACTATGGACCACGAGCTTGTACAGGCTCCTGAACTGGAGAAACCGTTCAAAATATTGTTAGCATTCTCAGGTTTG
AGGCAGGCATTGACCACCAACCCAGGATATAATCTGCGAGTTTCTGAGTGTCAAGAGGCTGCAAAAGTTCTTTTGACTGC
ATCTGGGAACAGCGAGCTGGAACCTACCTTGTGCAATGTTGAGCATGCGGTCTATGAAGCTCACAAGCATGAGCTGAAAC
CGGTTTTAGCTAAAAGAGCAGAGCATTATTTCTCGGAAAACATGCGGGTTATCAAAGGACGGGAAGCCTGGGCTTCAGGC
AATCTTGAAGAATTTGGAAAGCTGATTTCAGCATCCGGCTTGAGTTCCATTGAGAATTACGAATGCGGTGCGGAGCCACT
AATCCAGCTATACAAGATTCTTCTGAAGGCTCCTGGTGTATATGGAGCTCGATTCAGCGGTGCAGGCTTTAGGGGATGTT
GTCTAGCCTTTGTAGATGCAGAAAAAGCTGAGGCAGCTGCTTCATATGTGAAGGATGAATATGAAAAGGCCCAACCGGAG
TTTGCTAAGAATCTGAATGGAGGAAAACCTGTTCTCATCTGTGAAGCAGGTGACGCTGCTCGTGTTCTTCTCTGA