Details for Lyrate rockcress Locus 16059378

Position : sca3 ( 5`- 3268279 .. 3269790 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16059378

Protein [Map View]
MFLSPGHSPRQISSPSPSSYSDDTIRSTPRSSFSEIIPRNPRKRMRVLDEDAYVEAIEKIIERDYFPDITKLRDRLDWIQ
AVKTRDPIQIRDAQLKIIERRGKKANHHVGDTEGKTQTPGSTFLRNFTPLDEFDGKTPRTPGVSGREFHGGEVDADAGDG
DIDLNLSLDEFFRRYTSEDNDSFSKILEKVNRKKKEKYGFLLEGEKEDGKSIEDLKRDRITDGYGTSDQPPSTLEGWKYT
AKNLLMYHPADRGEAPLTEAERAVRLLGLTKEIVKGNTRFHGKTMDSRPREDGSVEILYTPIAGSSPMHISGRDRDKSKR
YDLDDLRKTPNPFYVESDKRADNGYSFVRTPSPAPGLDESPFITWGEIDGTPMRLDPEDTPIDIGGSADGPHYNIPSAPP
RDVRAHSLSRDASRKIRERSNSMFKKPPLPSPHRSGSASPNVRTLSPAAQKFFRRAIAKSSSTVDESLRASYRGASPGAV
TPKSVRSVSRFGKDGTSSETRSP*

DNA
ATGTTTCTATCGCCTGGTCATTCTCCGCGGCAGATTTCTTCTCCATCGCCGTCGTCTTATTCCGATGATACCATCCGATC
GACGCCTCGCAGTTCTTTCTCGGAGATCATTCCTCGGAACCCTAGAAAACGGATGAGAGTTCTTGATGAAGATGCGTATG
TTGAAGCAATCGAGAAGATCATCGAGCGTGATTACTTTCCGGATATAACTAAGCTTAGGGATCGGCTCGATTGGATCCAA
GCGGTTAAAACCCGTGACCCGATTCAAATCCGAGATGCCCAGTTGAAGATTATCGAGAGGCGTGGAAAGAAGGCGAATCA
TCATGTTGGGGACACCGAGGGTAAAACTCAAACTCCTGGATCTACTTTTCTCAGAAATTTTACTCCTTTAGATGAATTCG
ATGGTAAAACCCCTAGAACTCCTGGAGTATCTGGTAGAGAATTTCATGGTGGTGAAGTAGATGCTGATGCTGGAGATGGA
GATATAGATCTAAATTTGTCCTTAGATGAGTTCTTTAGGAGATATACAAGTGAGGATAATGATAGCTTTTCGAAGATTCT
TGAGAAGGTAAATAGGAAGAAGAAGGAGAAGTATGGCTTTCTCCTTGAAGGTGAAAAGGAGGATGGGAAATCGATTGAGG
ATTTAAAGAGAGATAGGATTACAGATGGGTATGGTACATCTGATCAGCCACCAAGCACTTTAGAAGGATGGAAATATACT
GCGAAGAATCTTCTGATGTACCATCCAGCTGATCGGGGTGAGGCGCCTTTAACTGAGGCTGAAAGGGCAGTGAGATTACT
TGGATTGACAAAGGAGATTGTTAAAGGGAACACTCGTTTTCATGGGAAGACTATGGATTCTAGGCCAAGAGAAGATGGCT
CAGTTGAGATTCTCTACACTCCAATCGCAGGTTCTTCCCCGATGCATATCTCAGGTAGGGACAGAGACAAATCTAAGAGA
TATGATCTTGATGATTTAAGGAAAACCCCAAATCCTTTCTATGTGGAATCAGATAAGAGGGCAGATAATGGGTATAGTTT
TGTTAGAACGCCTTCTCCTGCTCCAGGTCTTGATGAATCACCATTTATAACATGGGGTGAAATTGATGGGACACCAATGC
GATTAGATCCCGAGGATACACCTATTGATATTGGTGGTAGTGCTGATGGACCGCACTACAACATTCCATCTGCACCTCCT
AGAGATGTAAGGGCACATTCATTATCAAGGGATGCATCGCGAAAAATTAGAGAGAGATCAAATAGTATGTTTAAGAAACC
TCCGTTGCCATCTCCTCATCGAAGTGGAAGTGCAAGTCCAAATGTTAGGACACTTTCACCTGCTGCTCAGAAGTTTTTCA
GACGGGCAATAGCTAAATCATCTTCTACTGTTGATGAGAGCCTTCGTGCAAGTTATCGTGGAGCAAGCCCTGGTGCTGTG
ACTCCTAAGAGTGTGAGAAGTGTTTCAAGATTCGGCAAAGATGGGACCAGCTCAGAGACAAGGTCGCCTTGA