Details for Lyrate rockcress Locus 16059372

Position : sca3 ( 5`- 2082840 .. 2084172 -3` )
Annotation : [B2G] rubber elongation factor family protein
External links : CoGe
PGDD synteny : 16059372

Protein [Map View]
MATQTDLAQPKLDMTKEEKERLKYLQFVQAAAVEALLRFALIYAKAKDKSGPLKPGVESVEGAVKTVVGPVYEKYHDVPV
EVLKYMDQKVDMSVTELDRRVPPVVKQVSAQAISAAQIAPIVARALASEVRRAGVVETASGMAKSVYTKYEPAAKELYAN
YEPKAEQCAVSAWKKLNQLPLFPRLAQVAVPTAAFCSEKYNDTVVKAAEKGYRVTSYMPLVPTERISKIFAEEKAETEPL
EFHPLD*

DNA
ATGGCTACTCAAACGGATCTCGCTCAGCCCAAACTTGATATGACCAAGGAGGAGAAAGAGAGGTTGAAGTATTTGCAATT
CGTGCAAGCTGCTGCTGTTGAAGCTCTGCTTCGCTTTGCTCTTATTTACGCTAAGGCAAAGGACAAGTCTGGTCCTTTGA
AACCTGGTGTTGAATCTGTTGAAGGAGCTGTCAAGACTGTCGTTGGTCCTGTCTACGAGAAATACCACGACGTCCCTGTT
GAGGTCCTTAAATACATGGACCAGAAGGTTGATATGTCTGTGACCGAGCTTGACCGTCGTGTCCCACCAGTTGTCAAGCA
AGTGTCTGCCCAAGCCATCTCAGCTGCTCAGATAGCACCCATTGTGGCCCGTGCGTTGGCCTCTGAGGTGCGACGTGCTG
GTGTTGTTGAAACCGCTTCTGGAATGGCTAAATCCGTCTACACCAAGTACGAACCTGCTGCTAAGGAGTTGTATGCAAAC
TATGAGCCGAAAGCAGAGCAGTGTGCCGTTTCAGCTTGGAAGAAGCTGAACCAGCTTCCTCTGTTCCCAAGGCTGGCTCA
AGTTGCTGTACCAACAGCTGCTTTCTGCTCTGAGAAGTACAATGATACTGTGGTTAAGGCTGCAGAGAAAGGGTACAGAG
TCACATCGTACATGCCATTGGTTCCAACAGAGAGGATCTCAAAAATCTTCGCTGAGGAGAAAGCTGAGACCGAGCCTTTG
GAGTTCCATCCACTTGATTGA