Details for Lyrate rockcress Locus 16059350

Position : sca3 ( 5`- 9681788 .. 9678958 -3` )
Annotation : [B2G] set domain-containing protein
External links : CoGe
PGDD synteny : 16059350

Protein [Map View]
MDSVCKTDEKIAALLSPLPTLQQQEYFNKLITSRRCNGIEVKLNETIGKGVYVNSEFQEDELILKDQILVGIQHSSNKVD
CLVCSFCFRFVGSIEKQIGRKLYFKNLGVSGCCDGDSSESGEDECVKYNGNEEQCGGSSSSHNTLPEGVVSSLMNGEMAL
PYTDMFPLPSPLSCPGGCQEAFYCSESCAEADWESSHSLLCTGEKSESNSREALGEFIKHANDTNDIFLLAAKAIAFTIL
RYRKLKAEHVDKKAKQSEPKQSLLLEAWKPVSIGYKRRWWDCIALPDDVDLSDEGAFRMQIKNLACTSLELLKTAIFDKE
CEALFSLEIYGNIIGMFELNNLDLVVASPVEDYFLYIDDLPDAEKEEAEEITRPFLDALGDEYSDCCQGTAFFPLQSCMN
HSCCPNAKAFKREEDKDGQAVIIALRRISKNEEVTISYIDEELPYKERQALLADYGFSCKCSKCLEDSSAV*

DNA
ATGGATTCCGTTTGCAAAACAGACGAGAAAATCGCCGCTCTTCTTTCTCCGCTTCCAACTCTCCAACAGCAGGAATATTT
CAACAAGCTTATAACTAGTAGAAGATGCAATGGCATCGAAGTGAAACTAAATGAAACCATTGGAAAAGGTGTTTATGTAA
ATTCAGAGTTTCAAGAAGATGAACTCATTTTGAAAGATCAGATTCTTGTTGGTATCCAACATTCTTCCAACAAGGTGGAT
TGTTTGGTTTGTAGTTTTTGTTTCCGGTTCGTTGGATCGATCGAGAAACAAATCGGCCGGAAACTCTATTTTAAGAATCT
CGGTGTTTCTGGTTGTTGTGACGGCGATTCATCTGAAAGCGGAGAAGATGAATGTGTGAAGTACAATGGAAATGAGGAAC
AATGTGGTGGAAGCAGTTCAAGCCATAATACTCTTCCGGAAGGAGTTGTTAGTTCTTTGATGAATGGCGAAATGGCATTG
CCGTACACTGATATGTTTCCTTTGCCTTCGCCTCTTTCGTGTCCTGGAGGATGTCAGGAGGCTTTCTACTGTAGTGAATC
ATGCGCAGAGGCAGATTGGGAGAGTTCTCATTCTTTACTTTGCACTGGTGAGAAGTCTGAATCAAATTCTAGAGAGGCGC
TTGGAGAGTTTATAAAACATGCTAATGATACAAATGATATTTTTCTCCTGGCTGCCAAGGCGATTGCCTTTACCATTCTA
AGGTACAGGAAACTGAAAGCAGAACATGTAGACAAAAAAGCAAAACAAAGTGAGCCAAAGCAGTCCCTACTCTTGGAGGC
ATGGAAACCAGTATCGATTGGATACAAAAGAAGGTGGTGGGACTGCATCGCATTGCCAGATGATGTTGATCTTTCTGATG
AAGGAGCCTTCAGGATGCAGATAAAGAATCTTGCATGTACGTCTTTGGAGCTCCTGAAGACAGCCATATTTGACAAAGAA
TGTGAAGCTCTGTTCTCCCTCGAAATCTATGGGAATATCATCGGCATGTTTGAGCTGAATAACCTAGACTTGGTGGTAGC
ATCACCAGTAGAGGACTATTTCTTGTATATTGACGATCTTCCTGATGCAGAAAAGGAAGAAGCCGAGGAAATCACGAGAC
CGTTTCTAGATGCTCTTGGTGATGAATACTCGGACTGTTGCCAAGGAACGGCCTTCTTCCCTCTGCAGAGCTGTATGAAC
CATTCTTGTTGCCCTAATGCAAAAGCCTTCAAAAGAGAAGAGGACAAAGACGGACAAGCAGTTATTATTGCGTTAAGACG
CATCAGCAAAAACGAAGAGGTGACGATTTCATATATCGACGAGGAGCTTCCGTACAAAGAGAGACAAGCATTACTTGCAG
ACTATGGTTTCAGCTGCAAGTGCTCCAAGTGTCTGGAAGATTCTTCAGCAGTTTGA